DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Pc

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster


Alignment Length:304 Identity:65/304 - (21%)
Similarity:110/304 - (36%) Gaps:64/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAPPNDHVE-EYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFR 77
            |...:|.|: .|..|||:.||...|..:..|||.|:....|||||..|:.: .:|:..:|     
  Fly    15 DNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILD-RRLIDIYE----- 73

  Fly    78 LHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQH-----SKSVQAKNTAGMSKMNQKKGKN 137
                    ...||..:||..|....|..|....::::.     ...|........|..:.|:.|.
  Fly    74 --------QTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKK 130

  Fly   138 IKK------TAGKIKDIENY-PKTQMPST------------SQVSTDSTEVFDGNPSATTTNMIK 183
            .||      ....||...|. .:::.|.|            .::...|:    .|.|.|..:.:.
  Fly   131 EKKHHHHHHHHHHIKSERNSGRRSESPLTHHHHHHHHESKRQRIDHSSS----SNSSFTHNSFVP 191

  Fly   184 SPRIQSLFSDLNLIEPTKDK--------DVGDTSLKTPPKSRRLIEFPQREDAPLSSKHVSPMLI 240
            .|...|..|:...:..||.|        .:|.| :||.|....:        .|..::.|:|   
  Fly   192 EPDSNSSSSEDQPLIGTKRKAEVLKESGKIGVT-IKTSPDGPTI--------KPQPTQQVTP--- 244

  Fly   241 RKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIKVTKSE 284
             .:.||.|.....:....|:::.:.....::..:.::|..|.:|
  Fly   245 -SQQQPFQDQQQAEKIASEAATQLKSEQQATPLATEAINTTPAE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 18/50 (36%)
ChSh 357..411 CDD:294039
PcNP_524199.1 CHROMO 25..77 CDD:214605 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.