DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx5

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_988907.2 Gene:cbx5 / 394502 XenbaseID:XB-GENE-972727 Length:200 Species:Xenopus tropicalis


Alignment Length:134 Identity:40/134 - (29%)
Similarity:63/134 - (47%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRNHQRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCM 65
            |.:.::|.:    ||..:...|||||||:|.:|.|.|:.:.|:||.||..|:|||||..|: :|.
 Frog    18 MGKKNKRAS----DASSSSEEEEYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNL-DCP 77

  Fly    66 KLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKM 130
            :|:|:|    .:.::|.                           |:|...:|:...|..||...:
 Frog    78 ELISEF----MKKYKKV---------------------------KETDPKAKTESTKRKAGSDDI 111

  Fly   131 NQKK 134
            ..||
 Frog   112 KAKK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 26/49 (53%)
ChSh 357..411 CDD:294039
cbx5NP_988907.2 CD_HP1alpha_Cbx5 37..85 CDD:349298 25/52 (48%)
CSD_HP1alpha_Cbx5 125..182 CDD:349302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.