DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cdyl

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:209 Identity:58/209 - (27%)
Similarity:86/209 - (41%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EYVVEKILGKR-FVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDF---------ESEVFR 77
            |..||.|:.|| ...|:.:.||:|.|:.:|::||||.:::.||.:.:.||         |..:.|
  Rat    54 ETQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLAR 118

  Fly    78 LHRKA---AAKSVGKS-KSSPSSSGPLITENGPSSSKKTQQHSKSVQ--AKNTAGMSKMNQKKGK 136
            .:|.:   |.|.:.:| .|:.|.:.|.....|.....||.|...:.|  .||||  ..:..:|..
  Rat   119 ANRASPSNARKQISRSTHSALSKTNPKALVVGKDHESKTNQLLATSQKFRKNTA--PSLANRKNM 181

  Fly   137 NIKKTAGKIKDIENYPKTQMPSTSQVSTD-----STEVFDG--------------------NPSA 176
            ::.|:..||.    .||:  |...:.|.|     |.|..|.                    .|.|
  Rat   182 DLAKSGIKIL----VPKS--PIKGRTSIDGFHGESPEKLDQGAEDTVTPEVTAEKPTGALLGPGA 240

  Fly   177 TTTNMIKSPRIQSL 190
            ....|...|||.||
  Rat   241 ERARMGSRPRIHSL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 20/58 (34%)
ChSh 357..411 CDD:294039
CdylXP_017456089.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.