DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx6

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006242056.1 Gene:Cbx6 / 315136 RGDID:1307314 Length:414 Species:Rattus norvegicus


Alignment Length:398 Identity:82/398 - (20%)
Similarity:148/398 - (37%) Gaps:111/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFES--------------- 73
            :..|.|:.:|...||.:.||||.|:..:.:||||.||:.: .:|::.||.               
  Rat    11 FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILD-SRLIAAFEQKERERELYGPKKRGP 74

  Fly    74 --EVFRLHRKAAAKSVGKS------KSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKM 130
              :.|.|..:|.|:::..|      |.|.|:|.|.:     .||....:..|.::.     ..:|
  Rat    75 KPKTFLLKARAQAEALRISDVHFSVKPSASASSPKL-----HSSAAVHRLKKDIRR-----CHRM 129

  Fly   131 NQK-------KGKN------IKKTAGKIKDIENYPKTQMPSTSQVSTDSTEVFD----GNPSATT 178
            :::       :|.|      |...:..::.|....|.:.|..:::.. :.:|.|    |..:|..
  Rat   130 SRRPLPRPDPQGGNPGLRPPISPFSETVRIINRKVKPREPKRNRIIL-NLKVIDKGPGGGSTAQG 193

  Fly   179 TNMIKSPRIQS---------LFSDLNLIEPTKDKDVGDTSLKTPPKSRRLIEFPQREDAPLSSKH 234
            |..:..|::.|         .||:..|....:....|..:|..||.:..:.....:.|  ::|..
  Rat   194 TGALARPKVPSRNRVIGKSKKFSESMLRTQIRHMKFGTFALYKPPPAPLVPSTAGKAD--VASSG 256

  Fly   235 VSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIKVTKSEPKTLGQIKFSSRSSD 299
            ...:|....:.|..:         .||||...|:.:..||:......|..|:|:.:...:.|.|:
  Rat   257 PGLLLATPAAAPFDA---------HSSSSSGCPSPTLQSSDPDDAPPKLLPETISRSASNWRESE 312

  Fly   300 GGHAASSLGAPKEG---------DIG----------LDLSGSDSMDSEVESMRRCPRRKRKKTYP 345
                ...|..|.|.         |:.          |:.:|:.|.:.|.               .
  Rat   313 ----VLDLSIPPEAAATGQRVPPDVTAAAGQALHTVLEATGTGSSEPEA---------------G 358

  Fly   346 DWKFPEMT 353
            ||: |||:
  Rat   359 DWR-PEMS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 17/47 (36%)
ChSh 357..411 CDD:294039
Cbx6XP_006242056.1 CHROMO 10..62 CDD:214605 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.