DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx8

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001029250.1 Gene:Cbx8 / 303731 RGDID:1565375 Length:366 Species:Rattus norvegicus


Alignment Length:328 Identity:75/328 - (22%)
Similarity:118/328 - (35%) Gaps:78/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVG 88
            :..|.:|.:|...||.:.||||.|:..:.:||||.||:.:. :|::.||      .|:...:..|
  Rat    11 FAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDA-RLLAAFE------EREREMELYG 68

  Fly    89 KSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPK 153
            ..|..|.....|:.....:.:|..:..|.|     |.|:  .....|::.:..|...:..|....
  Rat    69 PKKRGPKPKTFLLKAQAKAKAKTYEFRSDS-----TRGI--RIPYPGRSPQDLASTSRAREGLRN 126

  Fly   154 TQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPT-----KDKDVGDTSLKTP 213
            |.:|...              |:|:|.....||.:....|......|     |....||:|.|..
  Rat   127 TGLPPPG--------------SSTSTCRADPPRDRDRDRDRERDRGTSRVDEKPSSPGDSSKKRG 177

  Fly   214 PKSRR-LIEFPQR------------------EDAP-----LSSKHVSPMLIRKESQPLQSSCTDD 254
            ||.|: |::..||                  ::.|     .|:.|....|.|::          |
  Rat   178 PKPRKELLDPSQRPLGEPSDGLGEYLKGRKLDETPSGIGKFSAGHSVIQLARRQ----------D 232

  Fly   255 SDL------GESSSSMSLPTVSSTSSEKSIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEG 313
            |||      ..||:..|....:.|...:.||...:..:..||   .:....|.....|.|.|  |
  Rat   233 SDLVQYGVTSPSSAEASGKLAADTFPARVIKHRAALLEAKGQ---GALDPGGTRVRHSSGTP--G 292

  Fly   314 DIG 316
            .:|
  Rat   293 SVG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 17/47 (36%)
ChSh 357..411 CDD:294039
Cbx8NP_001029250.1 CD_polycomb_like 11..59 CDD:349277 19/54 (35%)
CBX7_C 326..358 CDD:407338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.