DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx5

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001100267.1 Gene:Cbx5 / 300266 RGDID:1306619 Length:191 Species:Rattus norvegicus


Alignment Length:111 Identity:43/111 - (38%)
Similarity:66/111 - (59%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL 78
            |:..::..|||||||:|.:|.|.|:.:.|:||.||..|:|||||.:|: :|.:|:|:|..:..::
  Rat    10 DSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNL-DCPELISEFMKKYKKM 73

  Fly    79 ----HRKAAAKSVG-KSKSSPSSSGPLITENGPSSSKKTQQHSKSV 119
                :.|...||.| |.|||.|:|...|      .|||.::.|..:
  Rat    74 KEGENNKPREKSEGNKRKSSFSNSADDI------KSKKKREQSNDI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 26/49 (53%)
ChSh 357..411 CDD:294039
Cbx5NP_001100267.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 26/49 (53%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.