DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx3

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001008314.2 Gene:Cbx3 / 297093 RGDID:1549705 Length:183 Species:Rattus norvegicus


Alignment Length:98 Identity:39/98 - (39%)
Similarity:56/98 - (57%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL 78
            :|.|    ||:||||:|.:|.|||:.:..:||.||.:.:|||||.||: :|.:|:     |.|..
  Rat    24 EAEP----EEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI-----EAFLN 78

  Fly    79 HRKAAAKSVGKSKSSPSSSGPLITENGPSSSKK 111
            .:||..:..|..:.|.|.|     |:..|.|||
  Rat    79 SQKAGKEKDGTKRKSLSDS-----ESDDSKSKK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 24/49 (49%)
ChSh 357..411 CDD:294039
Cbx3NP_001008314.2 CD_HP1gamma_Cbx3 29..78 CDD:349299 25/54 (46%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.