DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and chp1

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_593666.1 Gene:chp1 / 2542239 PomBaseID:SPAC18G6.02c Length:960 Species:Schizosaccharomyces pombe


Alignment Length:329 Identity:78/329 - (23%)
Similarity:131/329 - (39%) Gaps:85/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NLGLVDAPPNDHVEEYVVEKILGKRF-VNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFE 72
            |.|..||      :.|.||.||..|. .||..:..:||:|:...:|||||.:|:....|::..: 
pombe    13 NEGETDA------DVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKW- 70

  Fly    73 SEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQK---K 134
                    |...|.:.|....|..:    .:|.....|:.::..:..:.|..:.:::::||   |
pombe    71 --------KKRKKLIAKGLLEPFDA----EDNEAKKMKREKEILRQQRQKRKSELTQLSQKVKEK 123

  Fly   135 GKNI-KKTAGKIKDIEN--------------YPKTQMPS-------TSQVSTDSTEVFDGNPSAT 177
            .|.: ||.|.:|..|.|              :.:..|..       |.:.||.||...:.:|...
pombe   124 FKKMRKKPARRIVTIANDEEEEDDQTMDEDAFERKSMQGELKERNLTDKTSTLSTSFGETSPDVN 188

  Fly   178 TTNMIKSPRI-------QSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRLI-------------EF 222
            ...:.:.|.:       :||.||   ..|.|:.::..|.| .|..|...:             .|
pombe   189 PFYLSEWPTVTDSILLSKSLSSD---AIPLKNGEIKSTML-MPSDSDNSVPGIQNSNNLENTGAF 249

  Fly   223 PQREDAPLSSKHVSPMLIRKESQPLQSS--CTDDSDLGES---SSSMSLPTVSSTSSEKSIKVTK 282
            .:..::|.|:   :|:...:.|.||..|  .|.|:|:..|   |:|..||:        |:|:.|
pombe   250 VENANSPQSN---TPLSTFRHSSPLSLSPVITSDNDVANSLFFSNSTPLPS--------SLKIKK 303

  Fly   283 SEPK 286
            ..||
pombe   304 EAPK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 18/50 (36%)
ChSh 357..411 CDD:294039
chp1NP_593666.1 CHROMO 21..>64 CDD:214605 17/42 (40%)
RRM 224..>371 CDD:223796 24/96 (25%)
RRM_SF 313..373 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.