Sequence 1: | NP_536794.1 | Gene: | rhi / 44879 | FlyBaseID: | FBgn0004400 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495224.2 | Gene: | heri-1 / 183036 | WormBaseID: | WBGene00016236 | Length: | 669 | Species: | Caenorhabditis elegans |
Alignment Length: | 247 | Identity: | 50/247 - (20%) |
---|---|---|---|
Similarity: | 89/247 - (36%) | Gaps: | 68/247 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 DHVEEYVVEKILG----------------KRFV----------NGRPQV------LVKWSGFPNE 51
Fly 52 NNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHS 116
Fly 117 KSVQAKNTAGMS------------------KMNQKKGKNIK--KTAGKIKDIENYPKTQMPSTSQ 161
Fly 162 VSTDSTEVFDGNPSATTTNMIKS---PRIQSLFSDLNLIEPTKDKDVGDTSL 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rhi | NP_536794.1 | CHROMO | 22..72 | CDD:237991 | 21/81 (26%) |
ChSh | 357..411 | CDD:294039 | |||
heri-1 | NP_495224.2 | CHROMO | 8..92 | CDD:214605 | 21/83 (25%) |
PKc | <208..345 | CDD:270622 | 11/34 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.970 |