DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and heri-1

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_495224.2 Gene:heri-1 / 183036 WormBaseID:WBGene00016236 Length:669 Species:Caenorhabditis elegans


Alignment Length:247 Identity:50/247 - (20%)
Similarity:89/247 - (36%) Gaps:68/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DHVEEYVVEKILG----------------KRFV----------NGRPQV------LVKWSGFPNE 51
            |...||.:|:|:.                |||.          ..:||:      ||||.|:.|:
 Worm     4 DSDSEYEIERIIDHVSFLEAYESFYGQNVKRFAAIFSEERFKRTKKPQLISNYFFLVKWLGYGNK 68

  Fly    52 NNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHS 116
            ..||||..|:.:.:.|....:.....::|.....|:..:......:.|:|.|       :.|:..
 Worm    69 EMTWEPESNIPDSVYLYEYKKLNNMVMNRMNLKVSLTFTSRRKGYTPPVILE-------ELQERK 126

  Fly   117 KSVQAKNTAGMS------------------KMNQKKGKNIK--KTAGKIKDIENYPKTQMPSTSQ 161
            ...|..|.:.|:                  |..:|.|:|:.  |...::..::|.  :...||:.
 Worm   127 PKPQFLNMSNMAITLNDNLNNGKFGIVPVPKYKKKFGQNVNYLKFGNEVYKMKNV--SFKDSTNN 189

  Fly   162 VSTDSTEVFDGNPSATTTNMIKS---PRIQSLFSDLNLIEPTKDKDVGDTSL 210
            ...:..:.......:...:|||.   .|::.||...|.:    |:.|..||:
 Worm   190 DIDNRVQQHHHEDRSFLQSMIKHNNIVRMRDLFVSYNKL----DETVNITSI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 21/81 (26%)
ChSh 357..411 CDD:294039
heri-1NP_495224.2 CHROMO 8..92 CDD:214605 21/83 (25%)
PKc <208..345 CDD:270622 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.