DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and hpl-1

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_510199.1 Gene:hpl-1 / 181450 WormBaseID:WBGene00001995 Length:184 Species:Caenorhabditis elegans


Alignment Length:135 Identity:39/135 - (28%)
Similarity:58/135 - (42%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAP--PNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVF 76
            |||  .......:||||:|.||...|..:..:||.|||....:|||:||: .|.:::.::|.|  
 Worm    25 DAPLFQESSSNVFVVEKVLNKRLTRGGSEYYIKWQGFPESECSWEPIENL-QCDRMIQEYEKE-- 86

  Fly    77 RLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKT 141
                 ||.::..|.:.||..|.....|..||:|                     ::..||.:|..
 Worm    87 -----AAKRTTRKRRYSPQPSTSSSAELQPSTS---------------------DEWAGKTLKTI 125

  Fly   142 AGKIK 146
            .|..|
 Worm   126 IGITK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 19/49 (39%)
ChSh 357..411 CDD:294039
hpl-1NP_510199.1 CD_HP1_like 36..85 CDD:349316 19/49 (39%)
ChSh 114..174 CDD:197638 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.