DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cec-4

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_501231.1 Gene:cec-4 / 177536 WormBaseID:WBGene00017990 Length:270 Species:Caenorhabditis elegans


Alignment Length:191 Identity:47/191 - (24%)
Similarity:85/191 - (44%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPN---ENNTWEPLENVGNCMKLVSDFES-----E 74
            :|...||.||::|..|.|.|.|..||:|.|:|:   .:..||  |::.||..|::.::.     :
 Worm    81 DDSSGEYAVERVLAHRKVKGSPLYLVQWKGYPHPVWNSEMWE--EDLDNCKDLLAAYKKHQEDLK 143

  Fly    75 VFRLHRKAAAKSVGKSKSS-------PS----SSGPLITENGPSSSKKTQQHSKSVQAKNTAGMS 128
            :.:..:|..:|:..|:..|       ||    .:||:..|     .|||.:.|.....:.|:..:
 Worm   144 IAQTPKKTPSKTPKKTPKSLKRRALTPSDDEEEAGPIAPE-----PKKTPKQSTKKLKRTTSPET 203

  Fly   129 KMNQKKGKNIKKTAGKIKDIENYPKTQ-----MPSTSQVSTDSTEVFDGNPSATTTNMIKS 184
            .:.:|.    ||.|  |.|:||:...|     :....::..|..:..:......||..:::
 Worm   204 NLVEKS----KKKA--IPDLENHTLDQEKNDVIERVEEIQEDEDDDDEQREEVVTTAPVET 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 20/52 (38%)
ChSh 357..411 CDD:294039
cec-4NP_501231.1 CHROMO 86..140 CDD:214605 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.