DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and hpl-2

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001022654.1 Gene:hpl-2 / 176506 WormBaseID:WBGene00001996 Length:303 Species:Caenorhabditis elegans


Alignment Length:328 Identity:71/328 - (21%)
Similarity:122/328 - (37%) Gaps:65/328 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PNDHVEEYVVEKILGKRFVN-GRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHR 80
            |.|:|  ::|||:|.||... ||.:.|::|.|||..:::|||.||: .|::::.:||.|..:..:
 Worm    14 PKDNV--FMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENL-QCVEMLDEFEREFSKREK 75

  Fly    81 KAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKI 145
            ....:...|.:.|...:.|   |......|:|.|:.|.             ..:||.:|...|..
 Worm    76 PIRKRHSQKPEPSEDQADP---EEDKDEKKETNQNDKF-------------SLEGKQLKCIVGLT 124

  Fly   146 KDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSL 210
            |.     ..::....:.|.|:..:.    .|...|....|.:.:....|......:.|.:.:   
 Worm   125 KG-----PGELHFLCKFSDDTARLL----PAKEVNSRYRPFVDAYGEFLKKKMERRHKRISE--- 177

  Fly   211 KTPPKSRRLIEFPQREDAPLSSKHVSP--MLIRKESQPLQ----SSCTDDSDLGESSSSMSLPTV 269
               .|.:|.||   .:||......:.|  .::..|...||    |..:.|.::.|:....:...:
 Worm   178 ---GKKKRSIE---EDDADDEWPEMPPGHRILTTEEHELQRRKESKISQDVEMTEAFQQTAADML 236

  Fly   270 SSTSSEKSIKVTKSEPKTLGQIKFSSRSSDGG-HAASSLGAPKEGDIGLDLSGSDSMDSEVESMR 333
            :......:..:..|.|:     .|...|.||. |.|:.|..               .|....|..
 Worm   237 NDMHMAANGDLLSSFPQ-----DFLEDSGDGEVHEAAILSV---------------FDDNSNSPP 281

  Fly   334 RCP 336
            .||
 Worm   282 PCP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 19/50 (38%)
ChSh 357..411 CDD:294039
hpl-2NP_001022654.1 CD_HP1_like 18..68 CDD:349316 21/52 (40%)
CD_CSD 109..>153 CDD:391946 10/65 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.