DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cec-3

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_495652.1 Gene:cec-3 / 174265 WormBaseID:WBGene00011636 Length:339 Species:Caenorhabditis elegans


Alignment Length:311 Identity:63/311 - (20%)
Similarity:125/311 - (40%) Gaps:68/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNC-MKLVSDF--------ESEVFR 77
            |.:.|||||..:..:....:.|:|.|:..:.:||||.|::..| .::|:::        ::|:..
 Worm    22 EIFEVEKILAHKVTDNLLVLQVRWLGYGADEDTWEPEEDLQECASEVVAEYYKKLKVTDKTELIE 86

  Fly    78 L-----------HRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMN 131
            |           ..|..:|:|...:|:..|.|...|......|||:.::...|.:|.....:|..
 Worm    87 LLQKQIKKNKSQKSKKRSKTVSDHESNHDSDGSYGTPKTSKKSKKSAKNETPVSSKVPKVPTKAA 151

  Fly   132 QKK----------GKNIKKTAGKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPR 186
            .|.          ..|.||.|.:::|      |:.....:.|:|       :.:.||..:....:
 Worm   152 LKSYEATVSGPVAPNNAKKAAMEVRD------TRRNWLDEESSD-------DEAETTAPLSDVEK 203

  Fly   187 IQSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRLIEFPQREDAPLSS----------KHVS----- 236
            |.|....:..:|...::.|...|  ||||.|.::......::|::|          |.::     
 Worm   204 IASKVKVVKAVEEKAEEPVKRPS--TPPKPREVVIKKDPSESPVASASSVIPTSKRKSINAETSN 266

  Fly   237 --------PMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIK 279
                    |::::.|:..........:|:..:.:.:.|.|.|:|...|.::
 Worm   267 GRQRTLAPPVIVKDETTWTVDGIARHTDVDNTKTKLILMTNSATGERKVVE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 16/58 (28%)
ChSh 357..411 CDD:294039
cec-3NP_495652.1 Chromo 25..75 CDD:278797 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.960

Return to query results.
Submit another query.