DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and C35E7.9

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_492824.1 Gene:C35E7.9 / 172987 WormBaseID:WBGene00016461 Length:301 Species:Caenorhabditis elegans


Alignment Length:143 Identity:32/143 - (22%)
Similarity:45/143 - (31%) Gaps:52/143 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RKAAAKSVGKSKSSPSSSGPLITENGPSS--SKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTA 142
            :|...|...:.|..|.   |.||.:.|..  .|..||..|.::..||            :.||..
 Worm   175 KKEDEKKEDEKKEEPK---PHITIDPPGDLMFKADQQEQKKLKLTNT------------HDKKIM 224

  Fly   143 GKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGD 207
            .|||                 |...:|:..||...|                  :||.|..::..
 Worm   225 FKIK-----------------TSDNQVYLMNPVYGT------------------VEPGKSANLTL 254

  Fly   208 TSLKTPPKSRRLI 220
            |..|.|.|..:|:
 Worm   255 TRNKAPAKEAKLV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991
ChSh 357..411 CDD:294039
C35E7.9NP_492824.1 Motile_Sperm 193..291 CDD:279029 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.