DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and C38D4.10

DIOPT Version :10

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001334200.1 Gene:C38D4.10 / 13189342 WormBaseID:WBGene00044225 Length:69 Species:Caenorhabditis elegans


Alignment Length:61 Identity:15/61 - (24%)
Similarity:23/61 - (37%) Gaps:18/61 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGP 106
            |.||.:.     ||:.|         :.||    .:||..||....|:.....|::.:..|
 Worm    15 SSFPQDF-----LEDSG---------DGEV----HEAAILSVFDDNSNSPPPCPIVVDTVP 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280 6/26 (23%)
CSD 362..411 CDD:349275
C38D4.10NP_001334200.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.