DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rhi and HP1Lcsd

DIOPT Version :9

Sequence 1:	NP_536794.1	Gene:	rhi / 44879	FlyBaseID:	FBgn0004400	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001246478.1	Gene:	HP1Lcsd / 12798145	FlyBaseID:	FBgn0263084	Length:	83	Species:	Drosophila melanogaster

Alignment Length:	51	Identity:	9/51 - (17%)
Similarity:	24/51 - (47%)	Gaps:	1/51 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   360 RGLDLDKILHCY-QMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYF 409
            ||..::||::.: ..|.:....:.:|....::.|...:.....|..:|:::
  Fly     8 RGRMVEKIVYVFTTANKNTMFLIKFKDSPVVEVVPGIEANRRIPQMVIEFY 58

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rhi	NP_536794.1	CHROMO	22..72	CDD:237991
rhi	NP_536794.1	ChSh	357..411	CDD:294039	9/51 (18%)
HP1Lcsd	NP_001246478.1	Chromo_shadow	12..63	CDD:279701	7/47 (15%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.000