DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx1

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001349489.1 Gene:Cbx1 / 12412 MGIID:105369 Length:185 Species:Mus musculus


Alignment Length:217 Identity:57/217 - (26%)
Similarity:90/217 - (41%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSD 70
            ::.|...|:....:..|||||||:|.:|.|.|:.:.|:||.||.:|:|||||.||: :|..|:::
Mouse     3 KKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENL-DCPDLIAE 66

  Fly    71 FESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKG 135
            |.......|.  ..||.|..:.:.|.|    .:.|..|..|                     ||.
Mouse    67 FLQSQKTAHE--TDKSEGGKRKADSDS----EDKGEESKPK---------------------KKK 104

  Fly   136 KNIKKTAGKIKDIENYPKTQMPSTSQVSTDS------------TEVFDGNPSATTTNMIKSPRIQ 188
            :..:|..|..:.:|       |.....:|||            ::..|..|:....  :|.|::.
Mouse   105 EESEKPRGFARGLE-------PERIIGATDSSGELMFLMKWKNSDEADLVPAKEAN--VKCPQVV 160

  Fly   189 SLFSDLNLI---EPTKDKDVGD 207
            ..|.:..|.   .|::|.|..|
Mouse   161 ISFYEERLTWHSYPSEDDDKKD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 26/49 (53%)
ChSh 357..411 CDD:294039
Cbx1NP_001349489.1 CD_HP1beta_Cbx1 20..69 CDD:349297 26/49 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 17/94 (18%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 11/65 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.