DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and CBX3

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_009207.2 Gene:CBX3 / 11335 HGNCID:1553 Length:183 Species:Homo sapiens


Alignment Length:98 Identity:39/98 - (39%)
Similarity:56/98 - (57%) Gaps:15/98 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL 78
            :|.|    ||:||||:|.:|.|||:.:..:||.||.:.:|||||.||: :|.:|:     |.|..
Human    24 EAEP----EEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENL-DCPELI-----EAFLN 78

  Fly    79 HRKAAAKSVGKSKSSPSSSGPLITENGPSSSKK 111
            .:||..:..|..:.|.|.|     |:..|.|||
Human    79 SQKAGKEKDGTKRKSLSDS-----ESDDSKSKK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 24/49 (49%)
ChSh 357..411 CDD:294039
CBX3NP_009207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/7 (29%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..125 11/33 (33%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.