DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx7b

DIOPT Version :10

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021335969.1 Gene:cbx7b / 101882803 ZFINID:ZDB-GENE-110613-2 Length:239 Species:Danio rerio


Alignment Length:127 Identity:32/127 - (25%)
Similarity:56/127 - (44%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVG 88
            :.||.|..||...|..:.|:||.|:|.:.:||||.|::.: .:||..:| |..:..|....:..|
Zfish    11 FAVESITKKRVRKGHVEYLLKWKGWPPKYSTWEPEEHILD-PRLVLAYE-EKEQKERSVVWRKRG 73

  Fly    89 KSKSSPSSSGPLITENGPSSSKKTQQHSKSV--------QAKNTAGMSKMNQKKGKNIKKTA 142
            :..........:.|.:..|:.:.|.|.|..:        |:.......::|..|.|...:|:
Zfish    74 RKPKRLHEQRSIYTMDLRSTHRHTDQSSAHLPLSLDPRFQSTEACIFQQLNHHKKKKRAETS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280 18/48 (38%)
CSD 362..411 CDD:349275
cbx7bXP_021335969.1 CD_Cbx7 7..62 CDD:349293 20/52 (38%)
CBX7_C 197..228 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.