DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx7b

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_009304967.1 Gene:cbx7b / 101882803 ZFINID:ZDB-GENE-110613-2 Length:239 Species:Danio rerio


Alignment Length:127 Identity:32/127 - (25%)
Similarity:56/127 - (44%) Gaps:10/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVG 88
            :.||.|..||...|..:.|:||.|:|.:.:||||.|::.: .:||..:| |..:..|....:..|
Zfish    11 FAVESITKKRVRKGHVEYLLKWKGWPPKYSTWEPEEHILD-PRLVLAYE-EKEQKERSVVWRKRG 73

  Fly    89 KSKSSPSSSGPLITENGPSSSKKTQQHSKSV--------QAKNTAGMSKMNQKKGKNIKKTA 142
            :..........:.|.:..|:.:.|.|.|..:        |:.......::|..|.|...:|:
Zfish    74 RKPKRLHEQRSIYTMDLRSTHRHTDQSSAHLPLSLDPRFQSTEACIFQQLNHHKKKKRAETS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 18/47 (38%)
ChSh 357..411 CDD:294039
cbx7bXP_009304967.1 CHROMO 10..62 CDD:214605 20/52 (38%)
CBX7_C 197..228 CDD:319236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.