DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx8a

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_991179.2 Gene:cbx8a / 100150672 ZFINID:ZDB-GENE-040405-1 Length:342 Species:Danio rerio


Alignment Length:346 Identity:68/346 - (19%)
Similarity:114/346 - (32%) Gaps:107/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFES--------------- 73
            :..|.|:.:|...||.:.||||.|:..:.:||||.||:.: .:|.:.||.               
Zfish    11 FAAESIIKRRIRRGRMEYLVKWKGWSQKYSTWEPEENILD-ERLFAAFEEREREREMYGPKKRGP 74

  Fly    74 --EVFRLHRKAAAKS----VGKSKS--------------------------------SPSSSGPL 100
              |.|.:..||.|||    .|:..|                                |..:.|..
Zfish    75 KPETFLMKAKAKAKSKTYEFGREMSRDIRVSFPVAEPVVTPRAREGLRTVVPTIFPPSTINRGES 139

  Fly   101 ITENGPSSSKKTQQHSKSVQA--------KNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQMP 157
            :....|.|.:.|..|..|:|.        |......||:...|.:.:....|..:..:|..::..
Zfish   140 VRVRPPDSERDTLTHGTSIQCPLDFTNSPKKRGPKPKMHPAGGSSSEGIKRKADESLSYRPSKTE 204

  Fly   158 STSQVSTDSTEVF----------DGNPSATTTNMIKSPRIQS-LFSDLNLIEPTKDKDVG----- 206
            .:.:.|......|          ||....:.::.:|.....| |.:.|.::...:....|     
Zfish   205 RSGETSNCDIMHFTQKYKAETNHDGKQMGSRSSDVKFSHGGSFLKAGLGILGHRQKVGSGGAINQ 269

  Fly   207 DTSLKTPPKSRRLIEFPQREDAPLSSKHVSPMLIRKESQ---PLQSSCTDDSDLG-----ESSSS 263
            ...:|.|||:.                     |.|...|   .|..|..||:|..     ::...
Zfish   270 QAKMKHPPKNN---------------------LFRSTDQTREQLSLSFVDDTDQSWLPCLKNMEK 313

  Fly   264 MSLPTVSSTSSEKSIKVTKSE 284
            :.:..|:|.|...:||.:.::
Zfish   314 IVVTDVTSNSLTVTIKESSTD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 17/47 (36%)
ChSh 357..411 CDD:294039
cbx8aNP_991179.2 Chromo <27..57 CDD:278797 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.