DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and Klp67A

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001286999.1 Gene:Klp67A / 39068 FlyBaseID:FBgn0004379 Length:814 Species:Drosophila melanogaster


Alignment Length:610 Identity:159/610 - (26%)
Similarity:246/610 - (40%) Gaps:190/610 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 SNVETGPQVFLRLRP-----VKDASKAYI-VSEEANVLITSCKVDST----------SNNVNRME 130
            |...|..:|.:|:||     ::...::.| |.:.:.:|....:.|..          .:...||.
  Fly     3 SEQHTNIKVAVRVRPYNVRELEQKQRSIIKVMDRSALLFDPDEEDDEFFFQGAKQPYRDITKRMN 67

  Fly   131 KH--FGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIP 190
            |.  ..|..:||.....:|:::.|..|   .::.....::..||.:|:|||:|:||.:...|:..
  Fly    68 KKLTMEFDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHPGLTY 132

  Fly   191 RALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDG 255
            ..::::|...|                  .|.|       :||                      
  Fly   133 LTMQDLFDKIQ------------------AQSD-------VRK---------------------- 150

  Fly   256 DHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTS 320
               |:          |.||::|:|||.|.:||.      |.|.     ||:..:...|.:.||..
  Fly   151 ---FD----------VGVSYLEVYNEHVMNLLT------KSGP-----LKLREDNNGVVVSGLCL 191

  Fly   321 VFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQS-SYKFCDLAGS 384
            ..:.|:||.||:|.||....|...|..||.|||||.:|.|.|....|...|.:: .....|||||
  Fly   192 TPIYSAEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTDTKRTVKLSMIDLAGS 256

  Fly   385 ERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEK 449
            ||..:|...|:|.||..:||.||:.||.|::..:...|.     ||||||.||.:|:.:|.|..:
  Fly   257 ERAASTKGIGVRFKEGASINKSLLALGNCINKLADGLKH-----IPYRDSNLTRILKDSLGGNCR 316

  Fly   450 LAMIVTVTPLDKYYEENLNVLNFASIAKNI--IFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTK 512
            ..|:..|:.....||:..|.|.:||.||.|  ..|:.|:|            |||.|   ..|.|
  Fly   317 TLMVANVSMSSLTYEDTYNTLKYASRAKKIRTTLKQNVLK------------SKMPT---EFYVK 366

  Fly   513 ELED---ENVRL------------QLE-------------------------IEQLKYDHVLQMQ 537
            ::::   ||.||            |||                         ..||: :|||.|:
  Fly   367 KIDEVVAENERLKERNKALEAKATQLERAGNSGFDPLELKTWYSKIDAVYAAARQLQ-EHVLGMR 430

  Fly   538 LLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQR--ESEF--------MLSSQRRRYEEQ- 591
               .|::   ...|::.:   ||:.| |..|.:.:.||  :.:|        .|:||..:|:|: 
  Fly   431 ---SKIK---NINYRQTL---KKELE-EFRKLMCVDQRVCQEDFRRFANYMSTLTSQMEKYKEEL 485

  Fly   592 -------------IEDLKDEIEELK 603
                         :|.||.|:.:.|
  Fly   486 PSWLSKMEIAYQDLESLKREVNKSK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 112/409 (27%)
Kinesin 93..479 CDD:278646 113/407 (28%)
GBP_C <512..603 CDD:303769 33/154 (21%)
coiled coil 576..586 CDD:293879 4/17 (24%)
coiled coil 592..603 CDD:293879 4/10 (40%)
Klp67ANP_001286999.1 KISc 8..353 CDD:214526 116/420 (28%)
KISc_KIP3_like 8..346 CDD:276821 114/413 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.