DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and Klp64D

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster


Alignment Length:570 Identity:174/570 - (30%)
Similarity:259/570 - (45%) Gaps:146/570 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EGASCATSAADSSNVETGPQVFLRLRPV-KDASKAYIVS----EEANVLITSCKVDSTSNNVNRM 129
            |.|:..|:|.....:| ..:|.:|.||: |:...|..:|    ::.|..||..|.::|:   |..
  Fly     4 EEANAGTTAQLDDEIE-NVRVVVRTRPMDKNELSAGALSAISVDKINRAITVMKPNATA---NEP 64

  Fly   130 EKHFGFTSIFDSTVGQRDIY-DTC--VGPKIMEEECVTIMTYGTSGSGKTYTLLGD---DVRAGI 188
            .|.:.|.::||....|.|:| ||.  :..|::|....||:.||.:|:|||||:.|:   ....||
  Fly    65 PKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGI 129

  Fly   189 IPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVI 253
            ||.|..:||                 |.|                                    
  Fly   130 IPNAFAHIF-----------------GHI------------------------------------ 141

  Fly   254 DGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKI-----VGNKGHV 313
                   .||..:...||.||::|||||.|.||         ||:...|:|::     :|    |
  Fly   142 -------AKAKENQKFLVRVSYMEIYNEEVRDL---------LGKDVGKSLEVKERPDIG----V 186

  Fly   314 FIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDI---------LKYNRSG 369
            |:|.|:...|.::::...::|||.:.....:|.:|..|||||.:|::.:         :::.|.|
  Fly   187 FVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQHVRMG 251

  Fly   370 ITTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDS 434
                 ..:..|||||||.:.|..||.|||||..||.||.|||..:.|  .|..|...  ||||:|
  Fly   252 -----KLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISA--LVDGKSTH--IPYRNS 307

  Fly   435 KLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI-----IFKEP--VIKQHRVS 492
            |||.|||.:|.|..|..|..|::|.|..|.|.::.|.:||.||||     |.:||  .:.:|   
  Fly   308 KLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKDALLRH--- 369

  Fly   493 YCGFM-EFSKM-STCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRREL-TATYQEI 554
               |. |.::: ...|.||   .||:|....: |.|....|.      ||..|..|| ::|.|.:
  Fly   370 ---FQEEIARLRKQLEEGD---SLEEEPPSSE-EEEDTADDE------LEAPLEIELESSTIQAV 421

  Fly   555 IQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKDEIEELKN 604
            .:..||:.|....:|..:|:|::|         ::::||..|.|.|.|:|
  Fly   422 EKKPKKKREKTDAEKEELAKRKNE---------HQKEIEHAKTEQETLRN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 129/412 (31%)
Kinesin 93..479 CDD:278646 130/410 (32%)
GBP_C <512..603 CDD:303769 25/91 (27%)
coiled coil 576..586 CDD:293879 1/9 (11%)
coiled coil 592..603 CDD:293879 5/10 (50%)
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 132/418 (32%)
Kinesin 26..352 CDD:278646 130/410 (32%)
RILP-like <437..556 CDD:304877 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.