DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and Klp61F

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster


Alignment Length:600 Identity:167/600 - (27%)
Similarity:264/600 - (44%) Gaps:163/600 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QVFLRLRPVKDASKAYIVSEEANV-----LITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDI 148
            ||::|:||:....:....:|..:|     ::|...:||      ::.|.|.|...|.....|.|:
  Fly    21 QVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDS------KLTKKFTFDRSFGPESKQCDV 79

  Fly   149 YDTCVGPKIME----EECVTIMTYGTSGSGKTYTLLG-----------DDVRAGIIPRALENIFT 198
            |...|.|.|.|    ..| |:..||.:|:|||:|::|           ||...|||||||     
  Fly    80 YSVVVSPLIEEVLNGYNC-TVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRAL----- 138

  Fly   199 IYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA 263
                                                                     .|:|:...
  Fly   139 ---------------------------------------------------------SHLFDELR 146

  Fly   264 STDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN---KGHVFIKGLTSVFVTS 325
            ..:|...:.:|::|:|||.:.|||:..         ....::|..:   ||.|.|:||..:.|.|
  Fly   147 MMEVEYTMRISYLELYNEELCDLLSTD---------DTTKIRIFDDSTKKGSVIIQGLEEIPVHS 202

  Fly   326 SEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYK-----FCDLAGSE 385
            .::..:||..|::|...|:|.:||.|||||.||:: ::....:||..:...|     ..||||||
  Fly   203 KDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSI-VVHIRENGIEGEDMLKIGKLNLVDLAGSE 266

  Fly   386 RVNNTGT-SGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEK 449
            .|:..|. .|:|::|..|||.||:.|||.:.|.     ...|..:|||:||||.|||.:|.|:.|
  Fly   267 NVSKAGNEKGIRVRETVNINQSLLTLGRVITAL-----VDRAPHVPYRESKLTRLLQESLGGRTK 326

  Fly   450 LAMIVTVTPLDKYYEENLNVLNFASIAKNI---------IFKEPVIKQHRVSYCGFMEFSKMS-- 503
            .::|.|::|..|..||.|:.|.:|..||||         :.|:.|:|::.      .|..|:.  
  Fly   327 TSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLKEYT------EEIDKLKRD 385

  Fly   504 -----------TCEG--GDYTKELEDENVRLQLEIEQLKYDHVLQMQLL-EEKLRRELTATYQEI 554
                       ..|.  |:.|.:||.:|..|..::..||   .|:.:|. :||:..|::.:..|.
  Fly   386 LMAARDKNGIYLAEETYGEITLKLESQNRELNEKMLLLK---ALKDELQNKEKIFSEVSMSLVEK 447

  Fly   555 IQNNKKQYEDECEKK--LLIAQRESEFMLSSQRRRYEEQIE----DLKDEIEELKNPASD----T 609
            .|..||..|:....|  ||:.::    :|:..:|||:|:.|    .:|.| :.|...|.:    .
  Fly   448 TQELKKTEENLLNTKGTLLLTKK----VLTKTKRRYKEKKELVASHMKTE-QVLTTQAQEILAAA 507

  Fly   610 DI-SDDPNESKSPIE 623
            |: :||.::....||
  Fly   508 DLATDDTHQLHGTIE 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 121/416 (29%)
Kinesin 93..479 CDD:278646 121/414 (29%)
GBP_C <512..603 CDD:303769 27/97 (28%)
coiled coil 576..586 CDD:293879 1/9 (11%)
coiled coil 592..603 CDD:293879 3/14 (21%)
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 125/427 (29%)
Kinesin 25..356 CDD:278646 121/414 (29%)
Microtub_bind 923..>1009 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.