DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and cana

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster


Alignment Length:566 Identity:126/566 - (22%)
Similarity:221/566 - (39%) Gaps:178/566 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKH---FGFTSI 138
            |..::|::    ||.:::||.:..             :||........::...:.|   :.|..:
  Fly     2 STKNASSI----QVCIKVRPCEPG-------------LTSLWQVKEGRSIQLADSHAEPYVFDYV 49

  Fly   139 FDSTVGQRDIYDTCVGPKIMEEECV-----TIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFT 198
            ||.....::::|...  |.:...|:     ||..||.:.||||||::||:...|::..|.:.||.
  Fly    50 FDEGASNQEVFDRMA--KHIVHACMQGSNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQ 112

  Fly   199 IYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA 263
                                                                         :..:
  Fly   113 -------------------------------------------------------------QISS 116

  Fly   264 STDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKN--LKIVGNKGHVFIKGLTSV----- 321
            .|:...|:.|.::|||||.:||||            .:||  |||     |....|:.:|     
  Fly   117 ETERDFLLRVGYIEIYNEKIYDLL------------NKKNQDLKI-----HESGNGIVNVNCKES 164

  Fly   322 FVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRS-----GITTQSSYKFCDL 381
            .|||.::.||.|.:|.:......|::|..|||||.:|.: |::..:|     ....||.....||
  Fly   165 IVTSEDDLLRQLYMGNKERVVGETNMNERSSRSHAIFRI-IIESRKSDHSDNDTVKQSVLSLVDL 228

  Fly   382 AGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAAS-TVQKKKNADIIPYRDSKLTMLLQAALL 445
            ||||:|:....:           :|||:....:.:.| :|..|.|:    :|||||..::..:|.
  Fly   229 AGSEQVDPADHA-----------SSLMIFRNLVKSLSESVDSKPNS----FRDSKLPRIMLPSLG 278

  Fly   446 GKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDY 510
            |....::|.|:||  .:.||:.:.::|.:.||.|..|..|.|..       .|.:.|...:.|  
  Fly   279 GNVLTSIICTITP--SFVEESSSTISFGTCAKKIRCKPQVCKID-------SETTMMRQLDRG-- 332

  Fly   511 TKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYEDECEKKLLIAQR 575
            ...|:|     :|..:::|.:..|.:|.||.:::|::.                    |::.:..
  Fly   333 ISMLKD-----KLAKKKIKNESQLVLQELEGRIKRDML--------------------KIVSSAS 372

  Fly   576 ESEFMLSSQRRRYEEQIEDLKDEIEELKNPASDTDISDDPNESKSP 621
            ..::.|..:||.:.......:.:...|..|        :|.||:.|
  Fly   373 LDDYRLQKRRRTWTLTASGSEGDAPVLALP--------EPEESRLP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 96/408 (24%)
Kinesin 93..479 CDD:278646 96/406 (24%)
GBP_C <512..603 CDD:303769 13/90 (14%)
coiled coil 576..586 CDD:293879 1/9 (11%)
coiled coil 592..603 CDD:293879 0/10 (0%)
canaNP_001027247.1 KISc 8..316 CDD:214526 100/422 (24%)
Motor_domain 8..310 CDD:277568 98/416 (24%)
SMC_prok_B <471..1270 CDD:274008
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.