DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and Klp59C

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:494 Identity:124/494 - (25%)
Similarity:192/494 - (38%) Gaps:127/494 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 REVRSFLMAR-----------DPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQS 65
            ||.|....||           ||.       .||.::.....:|..:.||          .:.:|
  Fly   129 RERRREAQARTRLDREQGKNEDPG-------NPNWEVARMIRLQREQMES----------QRVRS 176

  Fly    66 SEATEGASCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCK----VDSTSNNV 126
            ....|..:|...           .|.:|.||::   :..:...|.:|:....|    |.....:|
  Fly   177 GTTNERINCHQI-----------MVCVRKRPLR---RKELADREQDVVSIPSKHTLVVHEPRKHV 227

  Fly   127 NR---MEKH-FGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDV 184
            |.   :|.| |.|..:||.......:|:....|   .|.:....|...||.:|||||||:.|.  
  Fly   228 NLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQ-- 290

  Fly   185 RAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRL 249
            ..|....:::.|:.:....||                  ::||.:...|                
  Fly   291 FPGRHQSSMDGIYAMAAKDVF------------------STLKTVPYNK---------------- 321

  Fly   250 KQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKG-HV 313
                             :::.|:.||.|||...|:||| :|.|         ..|:::.::. .|
  Fly   322 -----------------LNLKVYCSFFEIYGTRVFDLL-MPGK---------PQLRVLEDRNQQV 359

  Fly   314 FIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKF 378
            .:.|||...|.::.|.|.||.||....|...||.|:.|||||.||.: :|: :.:|......:..
  Fly   360 QVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQI-VLR-SAAGEKLHGKFSL 422

  Fly   379 CDLAGSER-VNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQA 442
            .||||:|| .:|:........|...||.||:||..|:.|..     :.:..:|:|.||||.:|:.
  Fly   423 IDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALG-----RQSSHLPFRGSKLTQVLRD 482

  Fly   443 ALLG--KEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI 479
            :.:|  |.|..||..::|.....|..||.|.:|...|.:
  Fly   483 SFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKEL 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 108/402 (27%)
Kinesin 93..479 CDD:278646 108/400 (27%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 108/415 (26%)
Kinesin 193..520 CDD:278646 107/399 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.