DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and unc-104

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_611155.3 Gene:unc-104 / 36876 FlyBaseID:FBgn0267002 Length:1739 Species:Drosophila melanogaster


Alignment Length:618 Identity:167/618 - (27%)
Similarity:250/618 - (40%) Gaps:221/618 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QVFLRLRP-----VKDASKAYIVSEEANVLITSCKV-DSTSNNVNRMEKHFGFTSIFDSTVGQRD 147
            :|.:|:||     :...||..|....|...||:.|| .:||::|.|..        ||.:....|
  Fly     5 KVAVRVRPFNSREIARESKCIIEMAGATTAITNPKVPPNTSDSVKRFN--------FDYSYWSHD 61

  Fly   148 IYDT----------CVGPKIMEEEC----VTIMTYGTSGSGKTYTLLG--DDVRAGIIPRALENI 196
            .:|.          .:|.::::...    |.|..||.:|:||:||::|  ::.:.||||...:::
  Fly    62 HHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEEQQEGIIPMICKDL 126

  Fly   197 FTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFET 261
            ||..|||                                                        ||
  Fly   127 FTRIQDT--------------------------------------------------------ET 135

  Fly   262 KASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHV----------FIK 316
               .|:...|.||::|||.|.|.|||  .||                |||::          :::
  Fly   136 ---DDLKYSVEVSYMEIYCERVRDLL--NPK----------------NKGNLRVREHPLLGPYVE 179

  Fly   317 GLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV-------DILKYNRSGITTQ- 373
            .|:.:.||..::...|:..|.:..|.|:|::|..|||||.|||:       |::    :.:||: 
  Fly   180 DLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLM----TNLTTEK 240

  Fly   374 -SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDA-ASTVQKKKN---ADIIPYRD 433
             |.....|||||||.::||..|.||||..|||.||..||:.:.| |....||||   ||.|||||
  Fly   241 VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTKKADFIPYRD 305

  Fly   434 SKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNIIFKEPVIKQHRVSYCGFME 498
            |.||.||:..|.|..|.|||..::|.|..|:|.|:.|.:|..||.|:.|..|             
  Fly   306 SALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVV------------- 357

  Fly   499 FSKMSTCEGGDYTKELEDENVRLQLEIEQLKYDHVLQMQLLEEKLRRELTATYQEIIQNNKKQYE 563
                           .||.|.:|   |.:||.:        .:|||..|.|...|:      |.|
  Fly   358 ---------------NEDANAKL---IRELKEE--------IQKLRDLLKAEGIEV------QEE 390

  Fly   564 DECEKKLLIAQ-------------------RESEFMLSSQRRRYEEQI---EDLKDEIEEL---- 602
            ||..|..:|..                   :.||.:::.....:||::   |:::.:.|.:    
  Fly   391 DELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEM 455

  Fly   603 ----------------KNPASDTDISDDPNESK 619
                            |......::::|||.|:
  Fly   456 GVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 132/432 (31%)
Kinesin 93..479 CDD:278646 133/430 (31%)
GBP_C <512..603 CDD:303769 25/132 (19%)
coiled coil 576..586 CDD:293879 2/9 (22%)
coiled coil 592..603 CDD:293879 2/33 (6%)
unc-104NP_611155.3 KISc_KIF1A_KIF1B 2..358 CDD:276816 137/469 (29%)
KISc 3..358 CDD:214526 137/469 (29%)
Kinesin_assoc 355..498 CDD:292801 31/179 (17%)
FHA 475..574 CDD:238017 4/14 (29%)
KIF1B 878..923 CDD:289208
DUF3694 1246..1347 CDD:289256
PH_KIFIA_KIFIB 1602..1704 CDD:269939
PH 1607..1700 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.