DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and neb

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_476817.1 Gene:neb / 35293 FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster


Alignment Length:724 Identity:161/724 - (22%)
Similarity:272/724 - (37%) Gaps:259/724 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PRREVR-SFLMARDPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYK----------- 62
            |..|:| ..||.|  :.||..|.||.:.:.             :.:|.:..:.|           
  Fly    25 PASEMRKKVLMTR--AEDREHRDRPEQLLN-------------TAFSGSTPQPKPKPTALNACYT 74

  Fly    63 ----YQSSEATEG---------ASCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLI 114
                |:::.:|.|         :||:.:....|.:|:                ...||||:|:::
  Fly    75 PSSLYRNANSTPGRAKTPGTGKSSCSRTKERDSLMES----------------CLSVSEESNMIV 123

  Fly   115 T---------SCKVDSTSN------NVNRMEKHFGFTSIFDSTVG-------------------- 144
            .         .|.....:|      |.|.:....|  |..|::.|                    
  Fly   124 AVRVRPLNALECTRGQVTNVVQVHGNSNELTVQAG--SSADASAGVTHFFSYDQVYYSCDPERKN 186

  Fly   145 ---QRDIYDTCVGPKI---MEEECVTIMTYGTSGSGKTYTLLG----DDV---------RAGIIP 190
               |..:::....|.|   .|.....:..||.:||||:|:::|    ||.         .|||||
  Fly   187 FACQAKVFEGTARPLIDTAFEGYNACLFAYGQTGSGKSYSMMGIEALDDAALDGGPPHDEAGIIP 251

  Fly   191 RALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDG 255
            |....:|                                                 :|::.|   
  Fly   252 RFCHELF-------------------------------------------------RRIEAV--- 264

  Fly   256 DHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGE-VP--------RKNLKIVGNKG 311
                  |:...:.|.|.||:.|||||.::|||::.......|| .|        |..||:   :.
  Fly   265 ------KSQQQLQVEVEVSYFEIYNEKIHDLLSVQHAAAATGESTPIQQQQQQQRPALKV---RE 320

  Fly   312 H----VFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTV------------ 360
            |    .::..|::..|.|.......|.:|..:...|||::|..|||||.:|.:            
  Fly   321 HPIFGPYVVDLSAHSVDSYSALRNWLAVGNSQRATASTAMNDKSSRSHSIFNIVLNLTDLSSDDG 385

  Fly   361 ---DILKYNRSGI--TTQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTV 420
               |......|.:  |.:|.....|||||||::.:|::|.|::|..:||.||:.||:.:.|.:..
  Fly   386 LSSDTDSSTASSLRQTRRSKISLVDLAGSERISVSGSNGERIREGVSINKSLLTLGKVIAALADS 450

  Fly   421 QKK---------KNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIA 476
            :|.         ..:..:|||:|.||.||:..|.|..|..|:.|::|...:.:|.|..|.:|..|
  Fly   451 RKAIANGPLGSGTPSTFVPYRESVLTWLLRENLGGNSKTVMLATISPASIHADETLATLRYACKA 515

  Fly   477 KNIIFKEPVIKQHRVSYCGFMEFSKMSTCEGGDYTKELEDENVR-LQLEIEQLKYDHVLQMQLLE 540
            ::|:.:..|                         .:...|:.:| |:.|:::||       .|..
  Fly   516 RSIVNRVKV-------------------------NESPHDKIIRDLRAEVDRLK-------SLRN 548

  Fly   541 E-KLRRELTATYQE------IIQNNKKQYEDECEKKLLIAQRESEFMLSSQRRRYEEQIEDLKD- 597
            | :.:|.|:.....      ||:.:..:.|.|..::.| |:||.|  ||..::.:.|::::.:| 
  Fly   549 EYERQRRLSGNSNNPVPRKIIIETSVDETEVEALRQQL-AERERE--LSRAQKSWMEKLKEAEDQ 610

  Fly   598 ---EIEELK 603
               |:..||
  Fly   611 RKSELRVLK 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 112/480 (23%)
Kinesin 93..479 CDD:278646 113/478 (24%)
GBP_C <512..603 CDD:303769 24/102 (24%)
coiled coil 576..586 CDD:293879 4/9 (44%)
coiled coil 592..603 CDD:293879 2/14 (14%)
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816 111/493 (23%)
KISc 120..525 CDD:214526 111/492 (23%)
Kinesin_assoc 524..657 CDD:292801 27/131 (21%)
FHA 634..740 CDD:238017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.