DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sub and CG14535

DIOPT Version :9

Sequence 1:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001285726.1 Gene:CG14535 / 34073 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster


Alignment Length:376 Identity:73/376 - (19%)
Similarity:128/376 - (34%) Gaps:117/376 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KHFGFTSIFDSTVGQRDIYDTCVG---PKIMEEECVTIMTYGTSGSGKTYTLLGD---------- 182
            |.|.|.::|.....|.|:..:.:.   |.::|.....::..|...:|:..|:||:          
  Fly   101 KMFAFDNLFTGEDKQSDVCASALSEVIPAVLEGSDGCLLAMGYPATGQAQTVLGELGGGSGSGSA 165

  Fly   183 -----DVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFL---QDDASLKELQIRKKLLDLC 239
                 ....|..|.|:..::...|:...:|.....:..|.|.:   :.||..::|.|        
  Fly   166 SGSGVACSLGAAPCAIAWLYKGIQERRQKSGARFSVRVSAVGVSATKPDALSQDLLI-------- 222

  Fly   240 PDISAHHQRLKQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNL 304
                            .|..|:..|..:.:                      :.|.||       
  Fly   223 ----------------SHAAESDDSPGIYL----------------------RDDFLG------- 242

  Fly   305 KIVGNKGHVFIKGLTSVFVTSSEEALRLL------RLGQQRSTYASTSVNANSSRSHCVFTVDIL 363
                        |.|.:...::|.|...|      ||....||.:.:|..|....|..:||:.:.
  Fly   243 ------------GPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLHVY 295

  Fly   364 KYN---RSGIT-TQSSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKK 424
            :|:   :.|:. .:|.....||.|.  .|..|  ||.|..          :|..|.|..:.|:..
  Fly   296 QYSLSRKGGVAGGRSRLHIIDLGGC--ANRNG--GLPLSG----------IGNILLAILSGQRHP 346

  Fly   425 NADIIPYRDSKLTMLLQAALLGKE-KLAMIVTVTPLDKYYEENLNVLNFAS 474
                 |::|..||.||:..|.... .:|::..|.| ::.|::.|:.:..||
  Fly   347 -----PHKDHPLTPLLKDCLAPITCHVAIVAHVRP-EQSYQDALSTIQIAS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
subNP_001286548.1 KISc 89..477 CDD:276812 73/376 (19%)
Kinesin 93..479 CDD:278646 73/376 (19%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 73/376 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.