Sequence 1: | NP_001033835.2 | Gene: | sdt / 44861 | FlyBaseID: | FBgn0261873 | Length: | 2020 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006506776.1 | Gene: | Lrguk / 74354 | MGIID: | 1921604 | Length: | 1341 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 56/202 - (27%) |
---|---|---|---|
Similarity: | 92/202 - (45%) | Gaps: | 27/202 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1813 YPRATHKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFE 1876
Fly 1877 ADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSL 1941
Fly 1942 DK----LRQKKLRNGEPFKEEELKDIIATAR-----DMEARWGHLFDMIIINNDTERAYHQLLAE 1997
Fly 1998 INSLERE 2004 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sdt | NP_001033835.2 | PDZ_signaling | <54..102 | CDD:238492 | |
L27 | 1423..1466 | CDD:295425 | |||
PDZ_signaling | 1562..1640 | CDD:238492 | |||
SH3_MPP5 | 1673..1734 | CDD:212969 | |||
Guanylate_kin | 1820..1994 | CDD:279019 | 50/183 (27%) | ||
GuKc | 1831..2002 | CDD:214504 | 48/180 (27%) | ||
Lrguk | XP_006506776.1 | leucine-rich repeat | 131..150 | CDD:275380 | |
internalin_A | <132..>333 | CDD:380193 | |||
leucine-rich repeat | 151..172 | CDD:275380 | |||
leucine-rich repeat | 173..194 | CDD:275380 | |||
leucine-rich repeat | 195..216 | CDD:275380 | |||
leucine-rich repeat | 217..238 | CDD:275380 | |||
leucine-rich repeat | 258..281 | CDD:275380 | |||
leucine-rich repeat | 282..300 | CDD:275380 | |||
leucine-rich repeat | 304..328 | CDD:275380 | |||
GMPK | 416..537 | CDD:238026 | 34/126 (27%) | ||
PHA03247 | <678..1233 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |