DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdt and Lrguk

DIOPT Version :9

Sequence 1:NP_001033835.2 Gene:sdt / 44861 FlyBaseID:FBgn0261873 Length:2020 Species:Drosophila melanogaster
Sequence 2:XP_006506776.1 Gene:Lrguk / 74354 MGIID:1921604 Length:1341 Species:Mus musculus


Alignment Length:202 Identity:56/202 - (27%)
Similarity:92/202 - (45%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1813 YPRATHKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFE 1876
            ||.      ::|.||...|:.||..||... |..|.....||:|....||...||||||:::.|:
Mouse   414 YPM------LILTGPAACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQEVFD 472

  Fly  1877 ADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSL 1941
            ..:...:|:....|....||.:.:.|..:...|....:::..:.::.|:.|..:|..:||.|...
Mouse   473 EMLNMGKFILTFNYGNHNYGLNRDTIEGIARDGLASCIHMELEGVRSLKYSYFEPRYILVVPMDK 537

  Fly  1942 DK----LRQKKLRNGEPFKEEELKDIIATAR-----DMEARWGHLFDMIIINNDTERAYHQLLAE 1997
            :|    ||:|.|     |...|::  ||.:|     .:..::...||.:|..:|.:.||.:|   
Mouse   538 EKYEGYLRRKGL-----FSRAEIE--IAVSRVDLYVKVNQKYPGYFDAVINADDMDIAYQKL--- 592

  Fly  1998 INSLERE 2004
             :.|.||
Mouse   593 -SELIRE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdtNP_001033835.2 PDZ_signaling <54..102 CDD:238492
L27 1423..1466 CDD:295425
PDZ_signaling 1562..1640 CDD:238492
SH3_MPP5 1673..1734 CDD:212969
Guanylate_kin 1820..1994 CDD:279019 50/183 (27%)
GuKc 1831..2002 CDD:214504 48/180 (27%)
LrgukXP_006506776.1 leucine-rich repeat 131..150 CDD:275380
internalin_A <132..>333 CDD:380193
leucine-rich repeat 151..172 CDD:275380
leucine-rich repeat 173..194 CDD:275380
leucine-rich repeat 195..216 CDD:275380
leucine-rich repeat 217..238 CDD:275380
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..300 CDD:275380
leucine-rich repeat 304..328 CDD:275380
GMPK 416..537 CDD:238026 34/126 (27%)
PHA03247 <678..1233 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.