Sequence 1: | NP_001033835.2 | Gene: | sdt / 44861 | FlyBaseID: | FBgn0261873 | Length: | 2020 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957018.1 | Gene: | guk1b / 393697 | ZFINID: | ZDB-GENE-020916-1 | Length: | 223 | Species: | Danio rerio |
Alignment Length: | 216 | Identity: | 69/216 - (31%) |
---|---|---|---|
Similarity: | 113/216 - (52%) | Gaps: | 34/216 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1820 RPIVLIGPPNIGRHELRQRLMADSER-FSAAVPHTSRARREGE---------------------- 1861
Fly 1862 ----VPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLK 1922
Fly 1923 LLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATAR-DME-ARWGHLFDMIIINN 1985
Fly 1986 DTERAYHQ----LLAEINSLE 2002 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sdt | NP_001033835.2 | PDZ_signaling | <54..102 | CDD:238492 | |
L27 | 1423..1466 | CDD:295425 | |||
PDZ_signaling | 1562..1640 | CDD:238492 | |||
SH3_MPP5 | 1673..1734 | CDD:212969 | |||
Guanylate_kin | 1820..1994 | CDD:279019 | 66/206 (32%) | ||
GuKc | 1831..2002 | CDD:214504 | 63/203 (31%) | ||
guk1b | NP_957018.1 | Gmk | 1..219 | CDD:223272 | 69/214 (32%) |
guanyl_kin | 5..213 | CDD:213788 | 67/208 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |