DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdt and Lrguk

DIOPT Version :9

Sequence 1:NP_001033835.2 Gene:sdt / 44861 FlyBaseID:FBgn0261873 Length:2020 Species:Drosophila melanogaster
Sequence 2:XP_017448017.1 Gene:Lrguk / 296968 RGDID:1308226 Length:1271 Species:Rattus norvegicus


Alignment Length:443 Identity:97/443 - (21%)
Similarity:165/443 - (37%) Gaps:103/443 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1601 LLHEGDEILEVNGQE---------LRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTG 1656
            |:.:.:||.|:.|.|         |.|..:..:..|     |||...::...:.....:.|....
  Rat   220 LILDNNEIEEITGLEKCISLTHLSLAGNRITTIKGL-----GTLPIKVLSVSNNQIETITGLEEL 279

  Fly  1657 SQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGE 1721
            ..|..|..:|...:.||                      ..:..|:|.||:.|| |..:...|.|
  Rat   280 KALQNLDLSHNQISSLH----------------------GLENHDLLEVINLED-NKIKELSEIE 321

  Fly  1722 EDQTLAGLIPSQSFQHQRET----------MKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRK 1776
            ..:.|..|......::..:|          |.|.:.|   |.:.:.|                .:
  Rat   322 YIENLPILRVLNLLRNPIQTKPEYWFFVIFMLLRLTE---LDQQKIK----------------VE 367

  Fly  1777 KKKKASSEAGYPLYATTAPDE--------TDPEEIL--TYEEVALYYPRATHKRPIVLIGPPNIG 1831
            :|..|.::...|.....|.|.        :.|:.|.  |...:...||.      ::|.||...|
  Rat   368 EKVYAVNKYDPPPEVVAAQDHMTHVVNSMSQPQRIFDSTLPSLDAPYPM------LILTGPEACG 426

  Fly  1832 RHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYY 1895
            :.||..||... |..|.....||:|....||...|||||::::.|:..:...:|:....|....|
  Rat   427 KRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFVSQEVFDEMLSMGKFILTFNYGNHNY 491

  Fly  1896 GTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDK----LRQKKLRNGEPFK 1956
            |.:.:.:..:...|....:::..:.::.|:.|..:|..:||.|...:|    ||:|.|     |.
  Rat   492 GLNRDTVEGIARDGLASCIHMELEGIRSLKYSYFEPRYILVVPMDKEKYEGYLRRKGL-----FS 551

  Fly  1957 EEELKDIIATAR-----DMEARWGHLFDMIIINNDTERAYHQLLAEINSLERE 2004
            ..|::  ||.:|     .:..::...||.:|..:|.:.||.:|    :.|.||
  Rat   552 RAEIE--IAVSRVDLYVKVNRKFPGYFDAVINADDLDIAYQKL----SELIRE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdtNP_001033835.2 PDZ_signaling <54..102 CDD:238492
L27 1423..1466 CDD:295425
PDZ_signaling 1562..1640 CDD:238492 12/47 (26%)
SH3_MPP5 1673..1734 CDD:212969 12/60 (20%)
Guanylate_kin 1820..1994 CDD:279019 48/183 (26%)
GuKc 1831..2002 CDD:214504 46/180 (26%)
LrgukXP_017448017.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.