DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdt and Guk1

DIOPT Version :9

Sequence 1:NP_001033835.2 Gene:sdt / 44861 FlyBaseID:FBgn0261873 Length:2020 Species:Drosophila melanogaster
Sequence 2:NP_032219.2 Gene:Guk1 / 14923 MGIID:95871 Length:219 Species:Mus musculus


Alignment Length:185 Identity:81/185 - (43%)
Similarity:115/185 - (62%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1820 RPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARR 1883
            ||:||.||...|:..|.::|..: |..|..:|.||:|..|.||..|.||:|:||:..:.||.|..
Mouse    26 RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGD 90

  Fly  1884 FVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQK- 1947
            |:||.|:....||||.||:|.|.|..:||||::..|.::.::.:||.|..:.|.|||||.|.|: 
Mouse    91 FIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRL 155

  Fly  1948 KLRNGEPFKEEELKDIIATAR-DME-ARWGHLFDMIIINNDTERAY---HQLLAE 1997
            :|||.|  .||.|...:|.|| ||| ::...|||::|||:|.::||   .|.|:|
Mouse   156 RLRNTE--TEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdtNP_001033835.2 PDZ_signaling <54..102 CDD:238492
L27 1423..1466 CDD:295425
PDZ_signaling 1562..1640 CDD:238492
SH3_MPP5 1673..1734 CDD:212969
Guanylate_kin 1820..1994 CDD:279019 78/180 (43%)
GuKc 1831..2002 CDD:214504 75/174 (43%)
Guk1NP_032219.2 Guanylate_kin 24..209 CDD:279019 81/185 (44%)
guanyl_kin 26..208 CDD:213788 80/183 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.