DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdt and LRGUK

DIOPT Version :9

Sequence 1:NP_001033835.2 Gene:sdt / 44861 FlyBaseID:FBgn0261873 Length:2020 Species:Drosophila melanogaster
Sequence 2:NP_001352629.1 Gene:LRGUK / 136332 HGNCID:21964 Length:1131 Species:Homo sapiens


Alignment Length:447 Identity:100/447 - (22%)
Similarity:166/447 - (37%) Gaps:102/447 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1601 LLHEGDEILEVNGQELRGKTV------NEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTG-SQ 1658
            |:.:|:||.|::|.|:....:      |::..:.|..:..:..|.:   |...:.::.|... ..
Human   220 LILDGNEIEEISGLEMCNNLIHLSLANNKITTINGLNKLPIKILCL---SNNQIEMITGLEDLKA 281

  Fly  1659 LAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEED 1723
            |..|..:|...:.|.                      ..:..|:|.||:.|| |.....||.|..
Human   282 LQNLDLSHNQISSLQ----------------------GLENHDLLEVINLED-NKIAELREIEYI 323

  Fly  1724 QTLAGL----IPSQSFQHQRE------TMKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKK 1778
            :.|..|    :.....|.:.|      .|.|.:.|                     ..:|..|.:
Human   324 KNLPILRVLNLLENPIQEKSEYWFFVIFMLLRLTE---------------------LDQKKIKVE 367

  Fly  1779 KKASSEAGY--PLYATTAPDE--------TDPEEIL--TYEEVALYYPRATHKRPIVLIGPPNIG 1831
            :|.|:...|  |.....|.|.        ..|:.|.  |...:...||.      ::|.||...|
Human   368 EKVSAVNKYDPPPEVVAAQDHLTHVVNSVMQPQRIFDSTLPSLDAPYPM------LILAGPEACG 426

  Fly  1832 RHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYY 1895
            :.||..||... |..|.....||:|....||...||||||::..|:..:...:|:....|....|
Human   427 KRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQDVFDEMVNMGKFILTFSYGNHKY 491

  Fly  1896 GTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDK----LRQKKLRNGEPFK 1956
            |.:.:.:..:...|....:::..:.::.|:.|..:|..:||.|.:.:|    ||:|.|     |.
Human   492 GLNRDTVEGIARDGLASCIHMEIEGVRSLKYSYFEPRYILVVPMNKEKYEGYLRRKGL-----FS 551

  Fly  1957 EEELKDIIATAR-----DMEARWGHLFDMIIINNDTERAYH---QLLAEINSLEREP 2005
            ..|::  .|.:|     .:...:...||.:|..:|.:.||.   ||:.|...|..||
Human   552 RAEIE--FAVSRVDLYIKINQNFPGYFDEVINADDLDVAYQKLSQLIREYLGLTEEP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdtNP_001033835.2 PDZ_signaling <54..102 CDD:238492
L27 1423..1466 CDD:295425
PDZ_signaling 1562..1640 CDD:238492 10/44 (23%)
SH3_MPP5 1673..1734 CDD:212969 12/64 (19%)
Guanylate_kin 1820..1994 CDD:279019 48/186 (26%)
GuKc 1831..2002 CDD:214504 48/183 (26%)
LRGUKNP_001352629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..96
LRR 1 129..149
leucine-rich repeat 131..150 CDD:275380
LRR <150..>337 CDD:227223 28/142 (20%)
LRR 2 150..171
leucine-rich repeat 151..172 CDD:275380
LRR 3 172..193
leucine-rich repeat 173..194 CDD:275380
LRR 4 194..215
leucine-rich repeat 195..216 CDD:275380
LRR 5 216..237 7/16 (44%)
leucine-rich repeat 217..238 CDD:275380 7/17 (41%)
LRR 6 238..259 2/20 (10%)
leucine-rich repeat 258..281 CDD:275380 3/25 (12%)
LRR 7 260..280 3/22 (14%)
LRR 8 281..302 4/42 (10%)
leucine-rich repeat 282..300 CDD:275380 4/39 (10%)
LRR 9 303..324 9/21 (43%)
leucine-rich repeat 304..328 CDD:275380 10/24 (42%)
GMPK 416..592 CDD:238026 48/188 (26%)
Atrophin-1 <784..1126 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.