DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP97A3

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:427 Identity:96/427 - (22%)
Similarity:172/427 - (40%) Gaps:99/427 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YGPIFRERLGGTQDAVFVSSANLMRGVFQHEGQYPQHPLPDAWTLYNQ-------QHACQRGLFF 151
            ||.|||... |.:..:.||..::.:           |.|.|....|::       .....:||..
plant   139 YGGIFRLTF-GPKSFLIVSDPSIAK-----------HILKDNAKAYSKGILAEILDFVMGKGLIP 191

  Fly   152 MEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPL 216
            .:|..|...||.:...|....:..|.......:.|:..:     .:|||:   :..|:.      
plant   192 ADGEIWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQK-----LDAAAL---KGEEVE------ 242

  Fly   217 LEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVF----EHSSRLMTFPPRLAQILR 277
            :|....|.:::::...:|....       .||...|.::..|:    |...|.::..|    :..
plant   243 MESLFSRLTLDIIGKAVFNYDF-------DSLTNDTGVIEAVYTVLREAEDRSVSPIP----VWD 296

  Fly   278 LPIWRDFEAN----------VDEVLREGAAIIDHCIR-VQEDQRRPHDE-------ALYHRLQAA 324
            :|||:|....          :::.|.:   :|..|.| |:|::.:.|:|       ::.|.|.|:
plant   297 IPIWKDISPRQRKVATSLKLINDTLDD---LIATCKRMVEEEELQFHEEYMNERDPSILHFLLAS 358

  Fly   325 --DVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE----------------R 371
              ||....::...:.::||..:|:|....|..:.|:.||.:..:|.:|                :
plant   359 GDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGDRFPTIQDMKK 423

  Fly   372 ATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPER 436
            ....:|:|:    |||||||..|.:.|....:..||.:.|::...:.:|::...|.|.|::..|:
plant   424 LKYTTRVMN----ESLRLYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSPLHWDDAEK 484

  Fly   437 VLPERWCI-----GETEQVHKSHGSLPFAIGQRSCIG 468
            ..||||.:     .||.|   :...|||..|.|.|||
plant   485 FNPERWPLDGPNPNETNQ---NFSYLPFGGGPRKCIG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 96/427 (22%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 96/427 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.