DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp12a4

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:516 Identity:112/516 - (21%)
Similarity:202/516 - (39%) Gaps:94/516 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIPRVKGLPVVGTLVDLIAAGGA---THLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANL--M 117
            |..::..|.:....:.:...||.   ..|.:..:|..:.||.|| ...|...:..|:|:.|.  .
  Fly    46 PFEQIPRLNMWALSMKMSMPGGKYKNMELMEMFEAMRQDYGDIF-FMPGIMGNPPFLSTHNPQDF 109

  Fly   118 RGVFQHEGQYPQHPLPDAWTLYNQQHACQR-------GLFFMEGAEWLHNRRILNRLLL---NGN 172
            ..||::||.:|..  |..:||...:...::       |:...:|..|...|.::|.:|:   |..
  Fly   110 EVVFRNEGVWPNR--PGNYTLLYHREEYRKDFYQGVMGVIPTQGKPWGDFRTVVNPVLMQPKNVR 172

  Fly   173 LNW--MDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFG 235
            |.:  |....:...:|:::.....|.||....:               ..:.||::|.:..:...
  Fly   173 LYYKKMSQVNQEFVQRILELRDPDTLEAPDDFI---------------DTINRWTLESVSVVALD 222

  Fly   236 TS---VLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFP--------PRLAQILRLPIWRDFEANVD 289
            ..   :....|...:|..| ..:.:.|..|..|...|        |:|.:::|.         :|
  Fly   223 KQLGLLKNSNKESEALKLF-HYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRA---------LD 277

  Fly   290 EVLREGAAIIDHCI-RVQEDQR----RPHDE-ALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAF 348
            .:.....|.:|..| |:.::.:    ||.:| ::..:|...|  ..:...:.:|:::|..|||:.
  Fly   278 GIQEVTLAYVDEAIERLDKEAKEGVVRPENEQSVLEKLLKVD--RKVATVMAMDMLMAGVDTTSS 340

  Fly   349 SSQWALFALSKEPRLQQRLAK--------------ERATNDSRLMHGLIKESLRLYPVAPFIGRY 399
            :....|..|:|.|..|.||.:              |.:..:...:...||||.||:|:.....|.
  Fly   341 TFTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVGNARV 405

  Fly   400 LPQDAQLGGHFIEKDTMV-LLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGS------- 456
            |.:||.|.|:.:...|.| ::.|....|| .:|.|....|||||.....:...|...:       
  Fly   406 LARDAVLSGYRVPAGTYVNIVPLNALTRD-EYFPQASEFLPERWLRSPKDSESKCPANELKSTNP 469

  Fly   457 ---LPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSVLR--MVTVPDRTLR 512
               |||..|.|.|:|:|:...:|.....|....|.:..  ..|.::..|  ::.:|:..|:
  Fly   470 FVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEF--NYPTENAFRSALINLPNIPLK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 107/492 (22%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 108/490 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.