DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4d8

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:541 Identity:114/541 - (21%)
Similarity:194/541 - (35%) Gaps:138/541 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LVDLIAAGGATHLHKYIDARHKQY---GPIFRERLGGTQ------DAVFVSSANLMRGVFQHEGQ 126
            :|.|..||...||.: .|.|.|..   |||....:|..|      ...|:.........|.|   
  Fly     7 VVLLFGAGWIIHLGQ-ADRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGREYVLKFGH--- 67

  Fly   127 YPQHPLPDAW-----------------TLYNQQHACQ------------RGLFFMEGAEWLHNRR 162
                 |...|                 .|.:|:|..:            .||...:|..|...|:
  Fly    68 -----LQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRK 127

  Fly   163 ILNRL----LLNGNLNWMDVHIESCTRRMVDQWKRRTAE------AAAIPL-----------AES 206
            |:...    :|...:...|.....|.:|:..:....|.:      |||:.:           |::
  Fly   128 IITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIAETAMGTKIYAQA 192

  Fly   207 GEIRSYELPLLE-QQLYRW---SIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMT 267
            .|...|...:.| ..|..|   |:.:...::|   .||.|.::.                     
  Fly   193 NESTPYAEAVNECTALLSWRFMSVYLQVELLF---TLTHPHLKW--------------------- 233

  Fly   268 FPPRLAQILRLPIWRDFEANVDEVLREG-----AAIIDHCIRVQEDQRRPHDEALYHRLQAADVP 327
               |..|::|  ..::|...|.|..|:.     :.::|   ...||.......||...|..:.|.
  Fly   234 ---RQTQLIR--TMQEFTIKVIEKRRQALEDQQSKLMD---TADEDVGSKRRMALLDVLLMSTVD 290

  Fly   328 G-----DMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE---------------RA 372
            |     |.|:......:....|||..:..:.|..||:.|.:|.::.:|               |.
  Fly   291 GRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRD 355

  Fly   373 TNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQL-----GGHFIEKDTMVLLSLYTAGRDPSHFE 432
            ..:.:.|..:||||||:||..|.:||.|..|.:.     |...|...:.:::.::...|.|..|.
  Fly   356 LGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFP 420

  Fly   433 QPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPV 497
            .|:..:|||...|......|   .:||:.|.|:|||::.|..::..:|.:...::|:..:.:. |
  Fly   421 NPDEFIPERHENGSRVAPFK---MIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR-V 481

  Fly   498 DSVLRMVTVPDRTLRLALRPR 518
            :.::.:|...:...:|.:|.|
  Fly   482 ECIVNIVLRSETGFQLGMRKR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 109/518 (21%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 95/474 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.