DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4aa1

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster


Alignment Length:406 Identity:88/406 - (21%)
Similarity:162/406 - (39%) Gaps:79/406 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAA------------- 199
            ||....|::|.::||::....   :.|.::..|::........::...|||.             
  Fly   128 GLITSSGSKWSNHRRLIQPAF---HHNLLEKFIDTFVDASQSLYENLDAEAVGTEINIAKYVNNC 189

  Fly   200 ----------AIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQI 254
                      .:|:.:.|:    ::.::|...:|.. :::....|....|    :...:.::|::
  Fly   190 VLDILNEAVLGVPIKKRGQ----DVAMMEDSPFRQG-KIMMPARFTQPWL----LLDGIYHWTKM 245

  Fly   255 VHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHDEALYH 319
            .:.......||..|..::.| .|..|..:...|     .|...::||.|.:.|..|...:|    
  Fly   246 ANDELNQKKRLNDFTRKMIQ-RRRQIQNNNNGN-----SERKCLLDHMIEISESNRDFTEE---- 300

  Fly   320 RLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKERAT----------- 373
                     |::... ...::|..|:...:..:.||.|::.|..|.|...|.||           
  Fly   301 ---------DIVNEA-CTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTM 355

  Fly   374 ---NDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPE 435
               ::.|.|...|||:|||||..|.|.|.|.::.:|..|.:...:.|.:..|...|....:..||
  Fly   356 TDLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIYPDPE 420

  Fly   436 RVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNEMPVDSV 500
            :..|||:....:|..| .:..|||:.|.|.|||.|.|:.::.:::.|....:::     :||.. 
  Fly   421 KFQPERFSPENSENRH-PYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQL-----LPVTG- 478

  Fly   501 LRMVTVPDRTLRLALR 516
               .|....|.|:.||
  Fly   479 ---KTTIAATFRITLR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 81/385 (21%)
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 81/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.