DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:441 Identity:98/441 - (22%)
Similarity:174/441 - (39%) Gaps:111/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GLFFMEGAEWLHNRRI----LNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGE 208
            ||....||.||.::::    ..|..:.|.|            |:|.:...:..:...: |:::.|
  Fly   117 GLLTSSGARWLKHQKLYAPAFERSAIEGYL------------RVVHRTGGQFVQKLDV-LSDTQE 168

  Fly   209 IRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEH-----SSRLMTF 268
            :..     .::.:.:.:::::|....|..       .|||:..|..:|...:.     ..|..:.
  Fly   169 VFD-----AQELVAKCTLDIVCENATGQD-------SSSLNGETSDLHGAIKDLCDVVQERTFSI 221

  Fly   269 PPRLAQILRLPIWRDFEANVDEVLR-EGAAIIDHCIRVQEDQRRPHDEALYHRLQAADV--PGDM 330
            ..|...:.||..:...:.....:|| |...||        .|||       |:|.|.:.  .|..
  Fly   222 VKRFDALFRLTSYYMKQRRALSLLRSELNRII--------SQRR-------HQLAAENTCQQGQP 271

  Fly   331 IKRIFVDLVIAA-----------------------GDTTAFSSQWALFALSKEPRLQQRLAKER- 371
            |.:.|:|:::.|                       .|..|.:..:.|:.||:...:||:.|:|: 
  Fly   272 INKPFLDVLLTAKLDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQR 336

  Fly   372 ---------ATNDSRL--MHGL---IKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLY 422
                     ..:.:||  ||.|   |:|:|||||..|.|.|.......:.|..:.|.|.|::.|.
  Fly   337 RIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLI 401

  Fly   423 TAGRDPSHFEQPERVLPERWCIGETEQVH-KSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQ 486
            ..|.:..:|:.|....|||: ...|..|. ::..|:||:.|.|.||..:.|:.|:.:||.:...:
  Fly   402 AMGYNEKYFDDPCTFRPERF-ENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRR 465

  Fly   487 FEM-----------------SCLNEMPVDSVL--RMVTVPDRTLRLALRPR 518
            ||:                 .|:.:...|.||  |:....:..:::.||.|
  Fly   466 FEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRKR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 91/416 (22%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 90/393 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.