DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4e3

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_523527.1 Gene:Cyp4e3 / 34291 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster


Alignment Length:421 Identity:100/421 - (23%)
Similarity:180/421 - (42%) Gaps:75/421 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TLYNQQHA-CQRGLFFMEGAEW-LHNRRILNRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAA 199
            |:|:..|. ...||....|::| .|.:.|......|...::.:|..|:..:.|. |.|:.:|...
  Fly   103 TIYDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMT-QLKKASAGDT 166

  Fly   200 AIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSL-DYFTQIVHKV----- 258
            .|...|....              .:::|:|....|..:....:..||: ..|..:.:.:     
  Fly   167 IIDFQEHANY--------------LTLDVICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAF 217

  Fly   259 --FEHSSRLMTFPPRLAQILR-LPIWRDFEANVDE----VLREGAAIIDHCIRVQEDQRRPHDE- 315
              |:.|:|:.:..|..:...: |...:||..::.|    .|:.|.:..||      |...|..: 
  Fly   218 HPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYALQNGGSKEDH------DPSLPRKKM 276

  Fly   316 ALYHRLQAADVPGDMIKR--IFVDL---VIAAGDTTAFSSQWALFALSKEPRLQQRLAKERA--- 372
            |....|.::.:.|..:.|  |:.::   :....|||.....::::.||:.|.:|::|.:|:.   
  Fly   277 AFLDTLLSSTIDGRPLTRQEIYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVM 341

  Fly   373 ---TNDS---------RLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAG 425
               .|.|         :.:...|||:.|:||..||||||..:|..:.|..:.|.|.:.|:|...|
  Fly   342 GHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLG 406

  Fly   426 RDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMS 490
            .:...|:.|....|||:    .|:.......|||:.|.|:|||::.||.:|.:::.:....||: 
  Fly   407 YNDRIFKDPHHFRPERF----EEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEV- 466

  Fly   491 CLNEMP-VDSVL----RMVT----VPDRTLR 512
                :| ||.::    |:.|    .||..|:
  Fly   467 ----LPAVDELVSTDGRLNTYLGLAPDEKLK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 93/396 (23%)
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 92/394 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.