DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4ac1

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_608916.1 Gene:Cyp4ac1 / 33754 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster


Alignment Length:266 Identity:69/266 - (25%)
Similarity:124/266 - (46%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 LPIWRDFEANVDEVLREGAAIIDHCIRVQEDQRRPHDE-------ALYHRLQAADVPGDMIKRIF 335
            |.|..||.:.:.|..|:         :.|:.|....||       |:...|.||:..|.:..:..
  Fly   252 LRIVHDFSSRIIERKRQ---------QFQQKQLGEVDEFGRKQRYAMLDTLLAAEADGQIDHQGI 307

  Fly   336 VD----LVIAAGDTTAFSSQWALFALSKEPRLQQRLAK--ERATNDS---------RLMH--GLI 383
            .|    .:....|||:....:.|..|:....:|::..:  |....||         :|::  .:|
  Fly   308 CDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDSDDISMFQFNKLVYLECVI 372

  Fly   384 KESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPERVLPERWCIGETE 448
            |||||::|..|||||...::..:.|..:.|||.:.:.:|...|||.||.:|:...|:|:....|.
  Fly   373 KESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHFPKPDLFQPDRFLPENTV 437

  Fly   449 QVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEM---SCLNEMPVDSVLRMVTVPDRT 510
            ..| ....:||:.|||:|||::.|:.::..||......|::   :.|.::..::.:.:.|..:..
  Fly   438 NRH-PFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQENIK 501

  Fly   511 LRLALR 516
            ::|:.|
  Fly   502 VKLSKR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 66/245 (27%)
Cyp4ac1NP_608916.1 p450 86..504 CDD:278495 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.