DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and CYP4V2

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:500 Identity:101/500 - (20%)
Similarity:178/500 - (35%) Gaps:169/500 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VFQHEGQYPQHPLPDAW-------TLYNQQHA----------------------CQRGLFFMEGA 155
            :.::..:|...||...|       .|||.::.                      ...||....|.
Human    77 IIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGN 141

  Fly   156 EWLHNRRIL----NRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPL 216
            :|...|::|    :..:|...|:.|:.......:::...                          
Human   142 KWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH-------------------------- 180

  Fly   217 LEQQLYR-------WSIEVLCCIMFGTSVLTCPKIQSSLD-YFTQIVHKVFEHSSRLMTFPPRLA 273
            :.|:.:.       .:::::|....|.::    ..||:.| .:.:.|:::.|...|.:..|    
Human   181 INQEAFNCFFYITLCALDIICETAMGKNI----GAQSNDDSEYVRAVYRMSEMIFRRIKMP---- 237

  Fly   274 QILRLPIW---------------------------RDFEANVDEVLR-----------EGAAIID 300
             .|.|.:|                           |..|.|.:|..|           :..|.:|
Human   238 -WLWLDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLD 301

  Fly   301 HCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAG-DTTAFSSQWALFALSKEPRLQ 364
            ..:.|.:|:.        :||...|:      |..||..:..| ||||.:..|:|:.|...|.:|
Human   302 LLLSVTDDEG--------NRLSHEDI------REEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQ 352

  Fly   365 QRLAKE----------RATNDS----RLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDT 415
            :::..|          .||.:.    |.:..:|||:|||:|..|...|.:.:|.::.|:.:.|.|
Human   353 KKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGT 417

  Fly   416 MVLLSLYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLL 480
            ..::..|...|||.:|..||...|||: ..|..|....:..:||:.|.|:|||::.|:.:..::|
Human   418 EAVIIPYALHRDPRYFPNPEEFQPERF-FPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTIL 481

  Fly   481 GRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLR--------LALRP 517
                     ||        :||...:.....|        |.|||
Human   482 ---------SC--------ILRHFWIESNQKREELGLEGQLILRP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 94/470 (20%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 100/499 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.