DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and Cyp4v3

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001129072.1 Gene:Cyp4v3 / 266761 RGDID:708530 Length:525 Species:Rattus norvegicus


Alignment Length:555 Identity:105/555 - (18%)
Similarity:204/555 - (36%) Gaps:173/555 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIPRV-KGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSAN--LMRG 119
            |||.| :..|:||                                     .|:|:...|  ..:.
  Rat    49 PIPSVARAYPLVG-------------------------------------HALFMKPNNTEFFQQ 76

  Fly   120 VFQHEGQYPQHPLPDAW-------TLYNQQHA----------------------CQRGLFFMEGA 155
            :.|:..::...|:...|       .||..::.                      ...||....|:
  Rat    77 IIQYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDKSFMYKFLQPWLGLGLLTSTGS 141

  Fly   156 EWLHNRRIL----NRLLLNGNLNWMDVHIESCTRRMVDQWKRRTAEAA-----AIPLAESGEIRS 211
            :|...|::|    :..:|.   :::||..|. ...:|::.::...:.|     .|.|.       
  Rat   142 KWRARRKMLTPSFHFTILE---DFLDVMNEQ-ANILVNKLEKHVNQEAFNCFFPITLC------- 195

  Fly   212 YELPLLEQQLYRWSIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQIL 276
                         :::::|....|.::    ..||:.|  ::.|..|:..|..:.       :.:
  Rat   196 -------------ALDIICETAMGKNI----GAQSNGD--SEYVRTVYRMSDMIY-------RRM 234

  Fly   277 RLP-IWRD-----FEANVD--EVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKR 333
            ::| .|.|     |:...|  :.|:......::.|..:.:.|:...:.:  ......:|....::
  Rat   235 KMPWFWFDLWYLMFKEGRDHKKGLKSLHTFTNNVIAERVNARKAEQDCI--GAGRGPLPSKTKRK 297

  Fly   334 IFVDLVIA------------------------AGDTTAFSSQWALFALSKEPRLQQRLAKE---- 370
            .|:||:::                        ..||||.:..|:|:.|...|.:|:::.||    
  Rat   298 AFLDLLLSVTDEEGNKLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQRKVDKELDDV 362

  Fly   371 ----------RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAG 425
                      ......:.:..:|||:||::|..|...|.|.:|.::.|:.|.|.|..::..|...
  Rat   363 FGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVAGYKISKGTEAVIIPYALH 427

  Fly   426 RDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQF--E 488
            |||.:|..||...|||: ..|..|....:..:||:.|.|:|||::.|:.:..::|.....:|  |
  Rat   428 RDPRYFPDPEEFQPERF-FPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILREFWIE 491

  Fly   489 MSCLNE---MPVDSVLRMVTVPDRTLRLALRPRTE 520
            .:...|   :..|.:||    |:..:.:.|:.|.|
  Rat   492 SNQKREELGLAGDLILR----PNNGIWIKLKRRHE 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 94/524 (18%)
Cyp4v3NP_001129072.1 CYP4V 76..515 CDD:410773 92/482 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.