DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sad and cyp-42A1

DIOPT Version :9

Sequence 1:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_507688.2 Gene:cyp-42A1 / 180236 WormBaseID:WBGene00013585 Length:511 Species:Caenorhabditis elegans


Alignment Length:304 Identity:68/304 - (22%)
Similarity:121/304 - (39%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SIEVLCCIMFGTSVLTCPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVD 289
            :::|:|....|||      |.:..|..:..:..||:....:      ..::||...:.|...|:.
 Worm   182 TLDVICEAALGTS------INAQKDPHSPYLDAVFKMKDIV------FQRLLRPHYFSDTIFNLI 234

  Fly   290 EVLREGAAIIDHCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRI------------FVDLVI-- 340
            ...:|.    |.|:::..:..   .:|:|.|....|..|.:.:.:            |:||::  
 Worm   235 GPGKEH----DECVKILHEFT---SKAIYARKAKVDAAGGVEQLLAQETAEGRRRMAFLDLMLDM 292

  Fly   341 --------------------AAGDTTAFSSQWALFALSKEPRLQQRLAKE--------------R 371
                                ...|||:.:..|.|..:...|.:|.::.||              .
 Worm   293 NSKGELPMEGICEEVDTFTFEGHDTTSAAMNWFLHLMGANPEIQSKVQKEIDEVLGEADRPVSYE 357

  Fly   372 ATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPSHFEQPER 436
            .....:.:....||:|||||..|.|.|...:|.|:.||.:...|.|::......:||.:::.||.
 Worm   358 DLGKLKYLEACFKETLRLYPSVPLIARQCVEDIQVRGHTLPSGTAVVMVPSMVHKDPRYWDDPEI 422

  Fly   437 VLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLL 480
            ..|||:..||.:.   .:..:||:.|.|:|||.|.|:.:...:|
 Worm   423 FNPERFITGELKH---PYAYIPFSAGSRNCIGMRFAMMEEKCIL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sadNP_650123.1 p450 63..497 CDD:299894 68/304 (22%)
cyp-42A1NP_507688.2 p450 35..499 CDD:278495 68/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.