DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and PCP1

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_011615.1 Gene:PCP1 / 852993 SGDID:S000003333 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:63/271 - (23%)
Similarity:95/271 - (35%) Gaps:106/271 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GSAAPFKWIPPFF--------IILATL-LEVLVF-LWVGADPPEDSLLVYRPDQRLQLWRFL-SY 141
            ||...|:.:|||.        ::.|.| :.|.|| ||                |..:.|||| .|
Yeast   124 GSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLW----------------QLPKCWRFLQKY 172

  Fly   142 ALL-----------------HASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGT 189
            .||                 |..:.|||.|:|....||..|..:.|:.....:||...:||||.:
Yeast   173 MLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFS 237

  Fly   190 ---------SVVDSEVFLVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFVF------- 238
                     ::|...   :||||.::.:|..  .|.|....:          ::||||       
Yeast   238 LWYPKLARLAIVGPS---LGASGALFGVLGC--FSYLFPHAK----------ILLFVFPVPGGAW 287

  Fly   239 -------------CDLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGGLRP 290
                         |.|.:.               |..|.||:.|::.|:..|..:.:.::   :.
Yeast   288 VAFLASVAWNAAGCALRWG---------------SFDYAAHLGGSMMGVLYGWYISKAVE---KQ 334

  Fly   291 RPLRWLALGVW 301
            |..|..|.|.|
Yeast   335 RQRRLQAAGRW 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 45/199 (23%)
PCP1NP_011615.1 Rhomboid 186..329 CDD:396315 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.