DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RBL10

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_173900.2 Gene:RBL10 / 839113 AraportID:AT1G25290 Length:343 Species:Arabidopsis thaliana


Alignment Length:246 Identity:55/246 - (22%)
Similarity:95/246 - (38%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EGSAAP----------FKWIPPFFIILATLLEVLVFLWVGADPPEDSLLVYRPD-----QRLQLW 136
            |||:.|          .:|       ...||.:.|.:::.....:..:|.:...     :|.|||
plant   111 EGSSNPETSKRNTVNGRRW-------TNVLLAINVIMYIAQIASDGKVLTWGAKINSLIERGQLW 168

  Fly   137 RFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGS----LGTSVVDSEVF 197
            |..:.::|||:.:||..|..:....|...|.:.|..|...:|:...:|..    ||:::  |..|
plant   169 RLATASVLHANPMHLMINCYSLNSIGPTAESLGGPKRFLAVYLTSAVAKPILRVLGSAM--SYWF 231

  Fly   198 ----LVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTR 258
                .|||||.::.|:.:....::.:...:|.|...||.:...:..::...|.||.         
plant   232 NKAPSVGASGAIFGLVGSVAVFVIRHKQMVRGGNEDLMQIAQIIALNMAMGLMSRR--------- 287

  Fly   259 PSVSYIAHMTGALAGISVGLLLLRQ--------------LDGGLRPRPLRW 295
              :....|:.|.|.|.::..||..|              :|....|..|||
plant   288 --IDNWGHIGGLLGGTAMTWLLGPQWKYEYTTRDGRRVFMDSAPIPLLLRW 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 40/165 (24%)
RBL10NP_173900.2 Rhomboid 161..309 CDD:279958 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.