DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RBL6

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001184975.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:287 Identity:66/287 - (22%)
Similarity:111/287 - (38%) Gaps:69/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RAKHHEGSAAPFKWIPPFFII--------------------------LATLLEVLVFLWVGADP- 119
            |.:.|.|......|:.|..::                          :|.||....|..:..:| 
plant     8 RGRKHRGDTQWTAWLTPTIVVANVSIFIVVMYTNDCPKTTTGANGDCVAKLLRRFSFQPLRENPF 72

  Fly   120 --PEDSLL----------VYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSL 172
              |..|.|          |.:.:::   ||.::...|||..:||..|:...::||:.||...|.:
plant    73 LGPSSSTLEKLGALDWKKVVQGNEK---WRLITAMWLHAGIIHLVMNMFDVIIFGIRLEQQFGFI 134

  Fly   173 RTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFV 237
            |.|:||:.....||:.:::...:...|||||.:..|:.|.|:.||.|:...:..:..|::.:..:
plant   135 RIGLIYLISGFGGSILSALFLQKSISVGASGALLGLMGAMLSELLTNWTIYKSKLCALLSFLFII 199

  Fly   238 FCDLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDG-----------GLRPR 291
            ..:|...|.            |.|...||:.|.|.|..:|.:||.|...           |.|.|
plant   200 AINLAIGLL------------PWVDNFAHIGGLLTGFCLGFILLMQPQSGWEEFRNSSQYGARAR 252

  Fly   292 ----PLRWLALGVWCIFSAFGIAFNLV 314
                |.:::...|..:....|:...||
plant   253 SKYNPCQYVLFFVAAVLVVAGLTVGLV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 42/152 (28%)
RBL6NP_001184975.1 Rhomboid 92..232 CDD:279958 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.