DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RBL3

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_196342.1 Gene:RBL3 / 830616 AraportID:AT5G07250 Length:346 Species:Arabidopsis thaliana


Alignment Length:306 Identity:76/306 - (24%)
Similarity:127/306 - (41%) Gaps:67/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GRRPKNRPLIGTVEEGEMPPSTVLQMPPAPLSSKSGLVLGVCCDQLMA------VQPVQRASGAA 69
            |.|..:|..||.              ||.|::..|....|   |..::      :.|:...:..|
plant    20 GSRGGDRNRIGP--------------PPLPVALSSSTEFG---DNALSSRWTSWLVPMFVVANVA 67

  Fly    70 A-----TKSNSPD-WGNHRAKHH-------EGSAAPFKWIPPFFIILATLLEVLVFLWVGADPPE 121
            .     ..:|.|: :.:||.:.|       ..|..|.:..|.|.....||.::....|       
plant    68 VFVVAMFVNNCPNHFESHRLRGHCVAKFLGRLSFEPLRTNPLFGPSSHTLEKLGALEW------- 125

  Fly   122 DSLLVYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGS 186
             |.:|    ::.:.||.|:...|||..:|||.|:|:.:..|:.||...|.:|.||||:...:.||
plant   126 -SKVV----EKKEGWRLLTCIWLHAGVIHLGANMLSLVFIGIRLEQQFGFVRIGVIYLLSGIGGS 185

  Fly   187 LGTSVVDSEVFLVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELA 251
            :.:|:.......|||||.::.||.:.|:.|..|:....:.:..|:.::..:..:|...:.     
plant   186 VLSSLFIRNSISVGASGALFGLLGSMLSELFTNWTIYSNKIAALLTLLFVILINLAIGIL----- 245

  Fly   252 MHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGGLRPRPLRWLA 297
                   |.|...||:.|.:.|..:|.:||      .||: .:|||
plant   246 -------PHVDNFAHVGGFVTGFLLGFILL------ARPQ-FKWLA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 43/152 (28%)
RBL3NP_196342.1 Rhomboid 128..269 CDD:396315 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.