DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RBL7

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_194038.1 Gene:RBL7 / 828406 AraportID:AT4G23070 Length:313 Species:Arabidopsis thaliana


Alignment Length:253 Identity:62/253 - (24%)
Similarity:101/253 - (39%) Gaps:58/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ATKSNSPDWGNHRAKHHEGSAAP----FKWIPPFFIILATLLEVLVFLWVGADP----------- 119
            :|.:.....|..|..::.|...|    ..||.| .:::|.::..:|.::....|           
plant     3 STAAEEDPEGGSRETNNGGETTPDMQWRSWIIP-IVVIANVVVFVVVMYYNDCPHKSHRCLAKFL 66

  Fly   120 ---------------PEDSLL-----------VYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQ 158
                           |..|.|           |:    :.|:||.|:...|||..:||..|:...
plant    67 GRFSFESFKSNPLLGPSSSTLEKMGALAWGKIVH----KRQVWRLLTCMWLHAGVIHLLANMCCV 127

  Fly   159 LLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASLLLNFGQM 223
            ...||.||...|.:|.|.||:.....||:.:.:...:...||||..::.||.|.|:.||:|:...
plant   128 AYIGVRLEQQFGFVRVGTIYLVSGFCGSILSCLFLEDAISVGASSALFGLLGAMLSELLINWTTY 192

  Fly   224 RHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLL 281
            .:..:.::.:::.|..:||            |.|.|.|...||:.|...|..:|.|||
plant   193 DNKGVAIVMLLVIVGVNLG------------LGTLPPVDNFAHIGGFFGGFLLGFLLL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 47/153 (31%)
RBL7NP_194038.1 Rhomboid 98..224 CDD:396315 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1037
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.