DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdf1a

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio


Alignment Length:167 Identity:45/167 - (26%)
Similarity:72/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVD 193
            |||..:||..|   .|||..||...:|..|:.....||.:.|.||..:||:...:.|:|.     
Zfish   688 PDQFYRLWLSL---FLHAGILHCLVSVCFQMTILRDLEKLAGWLRISIIYILSGITGNLA----- 744

  Fly   194 SEVFL-----VGASGGVYALLAAQLASLLLNF---GQMRHGVIQLMAVILFVFCDLGYALYSREL 250
            |.:||     ||.:|..:.:||.....|:.::   .|......:|:.|:||:|   .:.|.    
Zfish   745 SAIFLPYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTKLLCVVLFLF---AFGLL---- 802

  Fly   251 AMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGG 287
                    |.:...||::|.::|..:....|..:..|
Zfish   803 --------PWIDNFAHISGFISGFFLSFAFLPYISFG 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 43/160 (27%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371
Rhomboid 685..826 CDD:279958 43/160 (27%)
DUF805 <792..864 CDD:294752 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.