DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdl2

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_957498.1 Gene:rhbdl2 / 792002 ZFINID:ZDB-GENE-040426-732 Length:294 Species:Danio rerio


Alignment Length:270 Identity:99/270 - (36%)
Similarity:147/270 - (54%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PVQRASGAAATKSNSPDW----GNHRAKHHEGSAAPFKWIPPFFIILATLLEVLVFLWVGADPPE 121
            ||:|.........|...|    ..|.......:..|    ||.||||.:|.|:.||::.....|:
Zfish    25 PVRRVRRVEKFHKNVSKWMLPEELHETYLERANCCP----PPIFIILISLAELAVFIYYAVWKPQ 85

  Fly   122 -----------DSLLVYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTG 175
                       ||.|.|||:||.:.|||:||..:||...|:..|:|.|||.|:||||||.....|
Zfish    86 KQWITLGTGIWDSPLTYRPEQRKEAWRFVSYMFVHAGVEHIMGNLLMQLLLGIPLELVHKGFEVG 150

  Fly   176 VIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASLLLNFGQMR--HGVIQLMAVILFVF 238
            ::||.|||||||.:|:.|....|||||||||||:.....:.::||.:||  .||.:::.::|.|.
Zfish   151 MVYMCGVLAGSLASSIFDPFSALVGASGGVYALMGGYFMNAIVNFREMRVLLGVFRILVIVLIVG 215

  Fly   239 CDLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGGLRPRPLRWLALGVWCI 303
            .|:|:||| |...:|:...:  ||::||:.|.:||:::|.:.....:..|...|..|:.:..:.:
Zfish   216 TDVGFALY-RRFIVHEAGLK--VSFVAHIGGGIAGMTIGYVFFTNYNKELLKDPRFWMCIVGYIV 277

  Fly   304 FSAFGIAFNL 313
            |..|.:.||:
Zfish   278 FLLFAVIFNI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 69/154 (45%)
rhbdl2NP_957498.1 Rhomboid 104..255 CDD:279958 69/153 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.